BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K11 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 3.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 3.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 3.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 8.2 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -1 Query: 191 RSFSTIKASKRCPASSRSPKVRF*SRQ-----SSEKLPTKHH 81 + FS+ +R P+SSRSP + Q + EK HH Sbjct: 26 KRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKSKNNHH 67 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 3.6 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 617 VVHRPDTKL 591 V+HRPDTKL Sbjct: 146 VIHRPDTKL 154 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.0 bits (47), Expect = 3.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 500 TAECKLKTATYSLPAFCCDLTSLVARSMQTIRQPVT 393 T + KL TY+L CDLT R + +R +T Sbjct: 351 TVQNKLYEETYALAPAGCDLTIDNLRKAKYLRACIT 386 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 3.6 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 617 VVHRPDTKL 591 V+HRPDTKL Sbjct: 146 VIHRPDTKL 154 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 516 SHTGXWRSCVELYSR 560 +++G WR CV + SR Sbjct: 99 TYSGLWRVCVAISSR 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,158 Number of Sequences: 438 Number of extensions: 4974 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -