BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K11 (848 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein ... 144 5e-35 At5g14460.1 68418.m01692 pseudouridylate synthase TruB family pr... 63 2e-10 At4g04130.1 68417.m00583 Ulp1 protease family protein contains P... 31 0.97 At1g70100.3 68414.m08067 expressed protein 31 1.3 At1g70100.2 68414.m08066 expressed protein 31 1.3 At1g70100.1 68414.m08065 expressed protein 31 1.3 At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, ... 30 1.7 At1g01900.1 68414.m00107 subtilase family protein contains simil... 30 2.2 At1g10140.1 68414.m01143 expressed protein similar to EST gb|AA5... 29 3.9 At5g03360.1 68418.m00289 DC1 domain-containing protein contains ... 29 5.2 At5g02350.1 68418.m00158 DC1 domain-containing protein contains ... 29 5.2 At1g66450.1 68414.m07549 DC1 domain-containing protein contains ... 29 5.2 At1g07220.1 68414.m00768 expressed protein 29 5.2 At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almo... 28 6.8 At1g62030.1 68414.m06996 DC1 domain-containing protein contains ... 28 6.8 >At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein NAP57, putative similar to SP|P40615 Dyskerin (Nucleolar protein NAP57) {Rattus norvegicus}; contains Pfam profiles PF01509: TruB family pseudouridylate synthase (N terminal domain), PF01472: PUA domain; supporting cDNA gi|8901185|gb|AF234984.2|AF234984 Length = 565 Score = 144 bits (350), Expect = 5e-35 Identities = 64/91 (70%), Positives = 79/91 (86%) Frame = +3 Query: 564 PRLISAVKRQLRVRTVYDSKLLDFDQDKNIGVFWVSCEAGSYIRTMCVHLGLMLGVGGQM 743 P LISAVKRQLR+RT+Y+SKLL++D D+++ VFWVSCEAG+YIRTMCVHLGL+LGVGG M Sbjct: 175 PPLISAVKRQLRIRTIYESKLLEYDADRHLVVFWVSCEAGTYIRTMCVHLGLLLGVGGHM 234 Query: 744 IELRRVRSGIQGXKEGMXTMHDILNAQWSYE 836 ELRRVRSGI G M TMHD+++AQ+ Y+ Sbjct: 235 QELRRVRSGILGENNNMVTMHDVMDAQFVYD 265 Score = 117 bits (282), Expect = 9e-27 Identities = 59/88 (67%), Positives = 68/88 (77%) Frame = +1 Query: 310 PQLPEVVSWIKRILKAEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQNAGKEYVAVFNL 489 P EVV+WIKRIL+ EKTGHSGTLDPKVTG LIVCIDRATRLVKSQQ AGKEYV V L Sbjct: 91 PSSHEVVAWIKRILRVEKTGHSGTLDPKVTGNLIVCIDRATRLVKSQQGAGKEYVCVARL 150 Query: 490 HSAVENIQKVTQGLGEAAWSSIPEAPGL 573 HSAV ++ KV + L E+ ++ + P L Sbjct: 151 HSAVPDVAKVARAL-ESLTGAVFQRPPL 177 Score = 105 bits (253), Expect = 3e-23 Identities = 46/85 (54%), Positives = 61/85 (71%) Frame = +2 Query: 65 KXKNKDGVSLGAFQTIGDFKIEPSESVKKLDTAYWPLLLKNFDRLNVRTNHYTPLPFGNS 244 K K +D A T GD+ I+P +DT+ WP+LLKN+DRLNVRT HYTP+ G+S Sbjct: 10 KKKKQDKTENDAADT-GDYMIKPQSFTPAIDTSQWPILLKNYDRLNVRTGHYTPISAGHS 68 Query: 245 PLKRPISDYVKSGFINVDKPSNPSS 319 PLKRP+ +Y++ G IN+DKP+NPSS Sbjct: 69 PLKRPLQEYIRYGVINLDKPANPSS 93 >At5g14460.1 68418.m01692 pseudouridylate synthase TruB family protein similar to SP|P09171 tRNA pseudouridine synthase B (EC 4.2.1.70) (tRNA pseudouridine 55 synthase) (Pseudouridylate synthase) (Uracil hydrolyase) {Escherichia coli O157:H7}; contains Pfam profile PF01509: TruB family pseudouridylate synthase (N terminal domain) Length = 540 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/75 (37%), Positives = 43/75 (57%) Frame = +1 Query: 337 IKRILKAEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQNAGKEYVAVFNLHSAVENIQK 516 ++R++K +K GH+GTLDP TG LIVC+ +AT++V Q K Y VF L A + Sbjct: 341 LRRLVKVKKVGHAGTLDPMATGLLIVCVGKATKVVDRYQGMIKGYSGVFRLGEATSTLDA 400 Query: 517 VTQGLGEAAWSSIPE 561 + + +W I + Sbjct: 401 DSPVIQRESWEHIKD 415 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 636 DQDKNIGVFWVSCEAGSYIRTMCVHLGLMLGVGGQMIELRR 758 D +N+ +F V C G+YIR++C L LG + LRR Sbjct: 475 DDRQNL-IFRVICSKGTYIRSLCADLAKALGSCAHLTALRR 514 >At4g04130.1 68417.m00583 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At2g11345, At3g42690 Length = 1200 Score = 31.1 bits (67), Expect = 0.97 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 80 DGVSLGAFQTIG-DFKIEPSESVKKLDTAYWPLLLKNFDRLNVRTN-HYTPLP 232 D V +T+G + K EPS++VK+ Y+P+ K F R + + + PLP Sbjct: 458 DDVEFVGTRTVGPEDKCEPSKAVKRAKKEYYPIRRKPFTRSSKKEGLNVEPLP 510 >At1g70100.3 68414.m08067 expressed protein Length = 504 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 179 LKNFDRLNVRTNHYTPLPFGNSPLKRPISDYVKSG 283 +K D+ NVRTNH P N K+P++ V SG Sbjct: 236 IKKTDK-NVRTNHMRASPKSNQVTKKPVTSKVVSG 269 >At1g70100.2 68414.m08066 expressed protein Length = 482 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 179 LKNFDRLNVRTNHYTPLPFGNSPLKRPISDYVKSG 283 +K D+ NVRTNH P N K+P++ V SG Sbjct: 236 IKKTDK-NVRTNHMRASPKSNQVTKKPVTSKVVSG 269 >At1g70100.1 68414.m08065 expressed protein Length = 467 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 179 LKNFDRLNVRTNHYTPLPFGNSPLKRPISDYVKSG 283 +K D+ NVRTNH P N K+P++ V SG Sbjct: 236 IKKTDK-NVRTNHMRASPKSNQVTKKPVTSKVVSG 269 >At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit (Ath-A), Arabidopsis thaliana Length = 1069 Score = 30.3 bits (65), Expect = 1.7 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = +1 Query: 403 CLIVCIDRATRLVKSQQNAGKEYVAVFNLHSAVENIQKVTQGLGEAAWSSIPEAPGL 573 CL C R R K+ K A +H A+ENI++ T+G +AA S PEA L Sbjct: 653 CLFCCGLRKNRKSKTTDKKKKNREASKQIH-ALENIEEGTKGTNDAAKS--PEAAQL 706 >At1g01900.1 68414.m00107 subtilase family protein contains similarity to cucumisin-like serine protease GB:AAC18851 GI:3176874 from [Arabidopsis thaliana] Length = 774 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 715 PKCTHIVRIYDPASQLTQNTPIFLSWSKSRSLLSYTV 605 P C ++V + +P + P L + K+R LSYTV Sbjct: 702 PTCEYMVHVEEPKGVKVRVEPKVLKFQKARERLSYTV 738 >At1g10140.1 68414.m01143 expressed protein similar to EST gb|AA598098 Length = 167 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +1 Query: 217 LHAATIRQLAFKTPHL*LRQIWLHQRRQTEQPQLPEVVSWIKRILKAEKTGHSGTLDPKV 396 + AA++R L K L Q L Q++Q +Q LP+ S ++ E+ G+++PKV Sbjct: 82 VRAASVRSLGHKNEIDMLIQEKLQQQKQQKQGGLPKSSSAGMARIEEEEETEEGSVNPKV 141 >At5g03360.1 68418.m00289 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1610 Score = 28.7 bits (61), Expect = 5.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 350 KIRFIHETTSGSWGCSVCRR 291 +I F H G W C VCR+ Sbjct: 333 RISFTHSFEKGDWSCGVCRK 352 >At5g02350.1 68418.m00158 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 350 KIRFIHETTSGSWGCSVCRR 291 +I FI SG W C VCR+ Sbjct: 294 RISFISSLPSGKWSCGVCRQ 313 >At1g66450.1 68414.m07549 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 700 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 350 KIRFIHETTSGSWGCSVCRR 291 +I FI G W C VCRR Sbjct: 322 RISFIRSFDQGDWSCGVCRR 341 >At1g07220.1 68414.m00768 expressed protein Length = 507 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 295 RQTEQPQLPEVVSWIKRILKA-EKTG 369 RQT QPQ P+ WI R L+ KTG Sbjct: 108 RQTHQPQCPDFFRWIHRDLEPWAKTG 133 >At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almost identical to DegP protease precursor GB:AF028842 from [Arabidopsis thaliana] (J. Biol. Chem. 273 (12), 7094-7098 (1998)) Length = 439 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +3 Query: 576 SAVKRQLRVRTVYDSKLLDFDQDKNIGVFWVSCEAGSYIRTMCVHLGLMLGVGGQMIEL 752 S ++ L +T +D+K++ FDQDK++ V + +R + V + L VG ++ + Sbjct: 179 SDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNK-LRPIPVGVSADLLVGQKVFAI 236 >At1g62030.1 68414.m06996 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 743 Score = 28.3 bits (60), Expect = 6.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 350 KIRFIHETTSGSWGCSVCRR 291 +I F H G W C VCRR Sbjct: 339 RISFNHSFGQGDWSCCVCRR 358 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,348,007 Number of Sequences: 28952 Number of extensions: 393309 Number of successful extensions: 1094 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -