BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K09 (865 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47790.1 68415.m05965 transducin family protein / WD-40 repea... 61 1e-09 At2g19540.1 68415.m02283 transducin family protein / WD-40 repea... 44 1e-04 At1g21650.1 68414.m02710 preprotein translocase secA family prot... 42 5e-04 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 41 0.001 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 40 0.002 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 40 0.003 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 39 0.004 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 39 0.004 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 39 0.004 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 39 0.005 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 38 0.009 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 38 0.011 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 38 0.011 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 38 0.011 At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ... 37 0.015 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 37 0.015 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 37 0.020 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 37 0.020 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 37 0.020 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 37 0.020 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 36 0.026 At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ... 36 0.026 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 36 0.026 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 36 0.026 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 36 0.026 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 36 0.035 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 36 0.035 At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf... 36 0.046 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 36 0.046 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 35 0.061 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 35 0.080 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 35 0.080 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 34 0.11 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 33 0.19 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 33 0.19 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 33 0.19 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 33 0.19 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 33 0.19 At3g45620.1 68416.m04927 transducin family protein / WD-40 repea... 33 0.25 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 33 0.25 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 33 0.25 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 33 0.25 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 33 0.32 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 33 0.32 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 33 0.32 At4g35370.1 68417.m05025 transducin family protein / WD-40 repea... 32 0.43 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 32 0.43 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 32 0.43 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 32 0.57 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 32 0.57 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 32 0.57 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 31 0.75 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 31 0.75 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 31 0.75 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 31 0.75 At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 ... 31 0.99 At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ... 31 0.99 At5g12920.1 68418.m01482 expressed protein contains 3 weak WD-40... 31 0.99 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 31 1.3 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 31 1.3 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 31 1.3 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 31 1.3 At4g18905.1 68417.m02787 transducin family protein / WD-40 repea... 31 1.3 At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 31 1.3 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 31 1.3 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 30 1.7 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 30 1.7 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 30 1.7 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 30 1.7 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 30 1.7 At5g50970.1 68418.m06321 WD-40 repeat family protein contains Pf... 30 2.3 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 30 2.3 At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 pro... 30 2.3 At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro... 30 2.3 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 30 2.3 At4g07410.1 68417.m01136 transducin family protein / WD-40 repea... 30 2.3 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 30 2.3 At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, put... 30 2.3 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 30 2.3 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 30 2.3 At5g58760.1 68418.m07360 transducin family protein / WD-40 repea... 29 3.0 At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 ... 29 3.0 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 29 3.0 At1g80710.1 68414.m09470 transducin family protein / WD-40 repea... 29 3.0 At5g37560.1 68418.m04523 zinc finger protein-related contains we... 29 4.0 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 29 4.0 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 29 4.0 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 29 4.0 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 29 4.0 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 29 4.0 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 4.0 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 29 4.0 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 29 4.0 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 29 5.3 At3g26480.1 68416.m03301 transducin family protein / WD-40 repea... 29 5.3 At1g20540.1 68414.m02559 transducin family protein / WD-40 repea... 29 5.3 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 28 7.0 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 28 7.0 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 28 7.0 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 28 7.0 At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochro... 28 7.0 At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochro... 28 7.0 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 28 9.2 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 28 9.2 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 28 9.2 At2g24680.1 68415.m02947 transcriptional factor B3 family protei... 28 9.2 At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase famil... 28 9.2 At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase famil... 28 9.2 >At2g47790.1 68415.m05965 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens]; The first 3 exons are identical to that of GB:AJ224957. This gene appears to be a truncated version of that in GB:AJ224957; contains 4 WD-40 repeats (PF00400) Length = 392 Score = 60.9 bits (141), Expect = 1e-09 Identities = 57/222 (25%), Positives = 100/222 (45%), Gaps = 4/222 (1%) Frame = +2 Query: 149 PEELEQMFSKKYKIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQV 328 P + + F K I T + + ++D T +A+SLS N++++Y + Sbjct: 22 PAQNVKKFGLKNSIQTNFGSDYVFQIVPKIDWTA---IAVSLSTNTVKLYSPVTGQYYGE 78 Query: 329 CRLHGHKEATLTQVVFSPKE---DNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILR 499 C+ GH + T+ Q+ FS ++L+S DG ++ WD R+ ++EI Sbjct: 79 CK--GHSD-TVNQIAFSSDSAASPHVLHSCSSDGTIRSWDTRSFQQVSRIDTGNDQEIFS 135 Query: 500 PYECMDVSCNGIVLCTGSQLVDDDAYLVFFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWR 679 + + N +L G + ++ +D R K + SH DDVTQ+ + Sbjct: 136 -FSYGGAADN--LLAGGCK-----EQVLLWDWRNSKQVACLEESHMDDVTQVHFVPNKPN 187 Query: 680 SLXSGSLDGLINVYXIXXEXEEDALLYS-LNVENSIDXLSWL 802 L S S+DGLI ++ + +D L S +NV SI + +L Sbjct: 188 KLLSASVDGLICLFNTEGDINDDDHLESVINVGTSIGKIGFL 229 >At2g19540.1 68415.m02283 transducin family protein / WD-40 repeat family protein contains WD-40 repeats (PF00400); similar to Glutamate-rich WD repeat protein (GRWD) (SP:Q9BQ67)[Homo sapiens] Length = 469 Score = 44.4 bits (100), Expect = 1e-04 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 3/139 (2%) Frame = +2 Query: 341 GHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDV 520 GH A++ + +SP E+N+ S +DG V +WDIR G S L +K ++ + Sbjct: 267 GHT-ASVEDLQWSPAEENVFASCSVDGSVAVWDIRLGKSPALSFKAHNADV------NVI 319 Query: 521 SCNGIVLCTGSQLVDDDAYLVFFDQRKPK---PLGGYWNSHTDDVTQIKSPRLEWRSLXS 691 S N + C + DD + + D R K + ++ H +T I+ E +L Sbjct: 320 SWNRLASCMLASGSDDGTFSI-RDLRLIKGGDAVVAHFEYHKHPITSIEWSAHEASTLAV 378 Query: 692 GSLDGLINVYXIXXEXEED 748 S D + ++ + E +E+ Sbjct: 379 TSGDNQLTIWDLSLEKDEE 397 >At1g21650.1 68414.m02710 preprotein translocase secA family protein contains Pfam profiles: PF01043 SecA protein, amino terminal region, PF00400 WD domain, G-beta repeat, PF00097 zinc finger, C3HC4 type (RING finger) Length = 1579 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/72 (34%), Positives = 38/72 (52%) Frame = +2 Query: 227 IHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYS 406 IH L ++ ++ DN+I+ + L D SL +C + GHK T VV + +LYS Sbjct: 589 IHALAYSEYGHVYTGSGDNTIKAWSLQDGSL--LCTMSGHKSVVSTLVVVN----GVLYS 642 Query: 407 TGLDGLVKLWDI 442 DG V+LW + Sbjct: 643 GSWDGTVRLWSL 654 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 40.7 bits (91), Expect = 0.001 Identities = 57/211 (27%), Positives = 90/211 (42%), Gaps = 9/211 (4%) Frame = +2 Query: 161 EQMFSKKYKIVTEHAVSLLHS---YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 331 + MF + Y T + + + YI + +L +S SD+ + KL D +C Sbjct: 77 DDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDML--IKLWDWEKGWLC 134 Query: 332 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPY 505 GH + QV F+PK+ N S LD +K+W++ GS + + L+ Sbjct: 135 TQIFEGHSHYVM-QVTFNPKDTNTFASASLDRTIKIWNL---GSPDPNFTLDAH--LKGV 188 Query: 506 ECMDVSCNG--IVLCTGSQLVDDDAYLVFFDQRKP--KPLGGYWNSHTDDVTQIKSPRLE 673 C+D G L TGS DD V+ Q K + L G HT +V+ + S E Sbjct: 189 NCVDYFTGGDKPYLITGS---DDHTAKVWDYQTKSCVQTLEG----HTHNVSAV-SFHPE 240 Query: 674 WRSLXSGSLDGLINVYXIXXEXEEDALLYSL 766 + +GS DG + ++ E+ L Y L Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGL 271 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +2 Query: 341 GHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEY 472 GH + ++ + F PK+ +LL S G+D VK+WD+ G C+ Y Sbjct: 280 GHTKG-VSAIRFFPKQGHLLLSAGMDCKVKIWDVYNSGKCMRTY 322 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 L S D ++ ++++ S + R+ HK + +T V F+P +DN S +DG V++WD Sbjct: 377 LLSSSVDETVRLWRVGSSD--ECIRVFSHK-SFVTCVAFNPVDDNYFISGSIDGKVRIWD 433 Query: 440 I 442 + Sbjct: 434 V 434 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 39.1 bits (87), Expect = 0.004 Identities = 58/211 (27%), Positives = 90/211 (42%), Gaps = 9/211 (4%) Frame = +2 Query: 161 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 331 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 332 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPY 505 GH + QVVF+PK+ N S LD +K+W++ GS + + + + Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL---GSPDPNFTLDAHQ--KGV 188 Query: 506 ECMDVSCNG--IVLCTGSQLVDDDAYLVFFDQRKP--KPLGGYWNSHTDDVTQIKSPRLE 673 C+D G L TGS DD V+ Q K + L G HT +V+ + E Sbjct: 189 NCVDYFTGGDKPYLITGS---DDHTAKVWDYQTKSCVQTLDG----HTHNVSAV-CFHPE 240 Query: 674 WRSLXSGSLDGLINVYXIXXEXEEDALLYSL 766 + +GS DG + ++ E+ L Y L Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGL 271 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 39.1 bits (87), Expect = 0.004 Identities = 58/211 (27%), Positives = 90/211 (42%), Gaps = 9/211 (4%) Frame = +2 Query: 161 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 331 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 332 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPY 505 GH + QVVF+PK+ N S LD +K+W++ GS + + + + Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL---GSPDPNFTLDAHQ--KGV 188 Query: 506 ECMDVSCNG--IVLCTGSQLVDDDAYLVFFDQRKP--KPLGGYWNSHTDDVTQIKSPRLE 673 C+D G L TGS DD V+ Q K + L G HT +V+ + E Sbjct: 189 NCVDYFTGGDKPYLITGS---DDHTAKVWDYQTKSCVQTLDG----HTHNVSAV-CFHPE 240 Query: 674 WRSLXSGSLDGLINVYXIXXEXEEDALLYSL 766 + +GS DG + ++ E+ L Y L Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGL 271 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 39.1 bits (87), Expect = 0.004 Identities = 58/211 (27%), Positives = 90/211 (42%), Gaps = 9/211 (4%) Frame = +2 Query: 161 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 331 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 332 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPY 505 GH + QVVF+PK+ N S LD +K+W++ GS + + + + Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL---GSPDPNFTLDAHQ--KGV 188 Query: 506 ECMDVSCNG--IVLCTGSQLVDDDAYLVFFDQRKP--KPLGGYWNSHTDDVTQIKSPRLE 673 C+D G L TGS DD V+ Q K + L G HT +V+ + E Sbjct: 189 NCVDYFTGGDKPYLITGS---DDHTAKVWDYQTKSCVQTLDG----HTHNVSAV-CFHPE 240 Query: 674 WRSLXSGSLDGLINVYXIXXEXEEDALLYSL 766 + +GS DG + ++ E+ L Y L Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGL 271 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 38.7 bits (86), Expect = 0.005 Identities = 40/136 (29%), Positives = 60/136 (44%) Frame = +2 Query: 392 NLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDD 571 +LL S G D LVKLWD R+G + + +L + + NG L T S+ D Sbjct: 281 SLLVSGGKDQLVKLWDTRSGRE-LCSLHGHKNIVL----SVKWNQNGNWLLTASK----D 331 Query: 572 AYLVFFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWRSLXSGSLDGLINVYXIXXEXEEDA 751 + +D R K L + HT DVT + SGS DG I + + E + Sbjct: 332 QIIKLYDIRTMKELQSF-RGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIE 390 Query: 752 LLYSLNVENSIDXLSW 799 + + +NS+ L+W Sbjct: 391 IPNA--HDNSVWDLAW 404 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 263 AISLSDNSIEIYKLSDS-SLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 ++ +S ++ KL D+ S ++C LHGHK L+ V + N L + D ++KL+D Sbjct: 281 SLLVSGGKDQLVKLWDTRSGRELCSLHGHKNIVLS--VKWNQNGNWLLTASKDQIIKLYD 338 Query: 440 IR 445 IR Sbjct: 339 IR 340 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 37.9 bits (84), Expect = 0.009 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 2/135 (1%) Frame = +2 Query: 215 LHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDS--SLHQVCRLHGHKEATLTQVVFSPKE 388 +HS +GTK LA D + I+ + S + L GH ++ + Q+ + PK Sbjct: 23 VHSVAWNSNGTK---LASGSVDQTARIWNIEPHGHSKAKDLELKGHTDS-VDQLCWDPKH 78 Query: 389 DNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDD 568 +L+ + D V+LWD R+ G C + + E I Y+ +G + G++ DD Sbjct: 79 SDLVATASGDKSVRLWDARS-GKCTQQVELSGENINITYK-----PDGTHVAVGNR--DD 130 Query: 569 DAYLVFFDQRKPKPL 613 + L D RK KPL Sbjct: 131 E--LTILDVRKFKPL 143 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 37.5 bits (83), Expect = 0.011 Identities = 32/109 (29%), Positives = 53/109 (48%) Frame = +2 Query: 395 LLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDDA 574 L S GLD L ++WD+R G S +L ++ ++P ++ S NG L +G +D Sbjct: 395 LAASCGLDSLARVWDLRTGRS-ILVFQGH----IKPVFSVNFSPNGYHLASGG----EDN 445 Query: 575 YLVFFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWRSLXSGSLDGLINVY 721 +D R K L +H + V+Q+K E L + S D +N++ Sbjct: 446 QCRIWDLRMRKSL-YIIPAHANLVSQVKYEPQEGYFLATASYDMKVNIW 493 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 562 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 619 Query: 431 LWDIRAGGSCVLEYKDEEEEI 493 WDI A SCV K ++ Sbjct: 620 FWDINA--SCVRAVKGASTQV 638 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 431 LWDIRAGGSCVLEYKDEEEEI 493 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 431 LWDIRAGGSCVLEYKDEEEEI 493 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 431 LWDIRAGGSCVLEYKDEEEEI 493 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 431 LWDIRAGGSCVLEYKDEEEEI 493 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 37.5 bits (83), Expect = 0.011 Identities = 57/211 (27%), Positives = 89/211 (42%), Gaps = 9/211 (4%) Frame = +2 Query: 161 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 331 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWEKGWAC 134 Query: 332 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPY 505 GH + QV F+PK+ N S LD +K+W++ GS + + + + Sbjct: 135 TQIFEGHSHYVM-QVTFNPKDTNTFASASLDRTIKIWNL---GSPDPNFTLDAHQ--KGV 188 Query: 506 ECMDVSCNG--IVLCTGSQLVDDDAYLVFFDQRKP--KPLGGYWNSHTDDVTQIKSPRLE 673 C+D G L TGS DD V+ Q K + L G HT +V+ + E Sbjct: 189 NCVDYFTGGDKPYLITGS---DDHTAKVWDYQTKSCVQTLEG----HTHNVSAV-CFHPE 240 Query: 674 WRSLXSGSLDGLINVYXIXXEXEEDALLYSL 766 + +GS DG + ++ E+ L Y L Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGL 271 >At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 WD-40 repeats (PF00400);low similarity to photomorphogenesis repressor (COP1) GI:2702280 [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea nil] Length = 343 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +2 Query: 251 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 430 S ++ + LSD S + +DS+L V GH + L F NL+Y+ D Sbjct: 131 STSIVVGLSDGSASVVSFTDSNLETVQEWKGH-DFELWTASFDLNNPNLVYTGSDDCKFS 189 Query: 431 LWDIR 445 WDIR Sbjct: 190 CWDIR 194 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = +2 Query: 254 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 L LA S D ++ ++ +D+ + + GH + +T + F P +D+L+ S D ++ Sbjct: 706 LRLATSSFDKTVRVWD-ADNKGYSLRTFMGHS-SMVTSLDFHPIKDDLICSCDNDNEIRY 763 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 W I GSC YK +I Sbjct: 764 WSIN-NGSCTRVYKGGSTQI 782 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 36.7 bits (81), Expect = 0.020 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +2 Query: 233 RLDGTKSLNLAISLSDNSIEIYK-LSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYST 409 R T S+ + S D +I ++ +S + + HG E +T VF+ K+ + S+ Sbjct: 181 RYSSTGSIYITAS-KDGAIRLFDGVSAKCVRSIGNAHGKSE--VTSAVFT-KDQRFVLSS 236 Query: 410 GLDGLVKLWDIRAGGSCVLEYKDEEEEILR 499 G D VKLW+I G V EY + LR Sbjct: 237 GKDSTVKLWEI-GSGRMVKEYLGAKRVKLR 265 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 36.7 bits (81), Expect = 0.020 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +2 Query: 233 RLDGTKSLNLAISLSDNSIEIYK-LSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYST 409 R T S+ + S D +I ++ +S + + HG E +T VF+ K+ + S+ Sbjct: 273 RYSSTGSIYITAS-KDGAIRLFDGVSAKCVRSIGNAHGKSE--VTSAVFT-KDQRFVLSS 328 Query: 410 GLDGLVKLWDIRAGGSCVLEYKDEEEEILR 499 G D VKLW+I G V EY + LR Sbjct: 329 GKDSTVKLWEI-GSGRMVKEYLGAKRVKLR 357 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 36.7 bits (81), Expect = 0.020 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 DNSI+++ L + L + L H ++ + + D L S LD VK+W GG+ Sbjct: 286 DNSIKVWSLDN--LQCIQTLTEHTSVVMSLICW----DQFLLSCSLDNTVKIWAATEGGN 339 Query: 458 CVLEYKDEEE-EILRPYECMDVSCNGIVLCT 547 + Y +EE +L D ++LC+ Sbjct: 340 LEVTYTHKEEYGVLALCGVHDAEAKPVLLCS 370 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 36.7 bits (81), Expect = 0.020 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +2 Query: 221 SYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLL 400 S+++RL+ T + + + I ++ ++ +S V H + V + + Sbjct: 36 SHVNRLEITPDKHYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNNVMA--VGFQCDAKWM 93 Query: 401 YSTGLDGLVKLWDIRAGGSCVLEYK 475 YS DG VK+WD+RA G C EY+ Sbjct: 94 YSGSEDGTVKIWDLRAPG-CQKEYE 117 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 36.3 bits (80), Expect = 0.026 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 D +++I+ +SD S + GH + L + + S G DGL+KLW++ Sbjct: 562 DKTVKIWAISDGSCLKT--FEGHTSSVLRASFIT--DGTQFVSCGADGLLKLWNVNT-SE 616 Query: 458 CVLEYKDEEEEI 493 C+ Y E+++ Sbjct: 617 CIATYDQHEDKV 628 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 341 GHKEATLTQVVFSPKED-NLLYSTGLDGLVKLWDIRA 448 GHK ++ ++F P + N+L S D V++WD+ A Sbjct: 142 GHK-GVVSSILFHPDSNKNILISGSDDATVRVWDLNA 177 >At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40 repeats (PF0400); Length = 415 Score = 36.3 bits (80), Expect = 0.026 Identities = 40/146 (27%), Positives = 60/146 (41%) Frame = +2 Query: 308 DSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEE 487 D L+ + GH E+ + V + K +NL S G DG + +WD R + K E Sbjct: 204 DKVLNAMFVYEGH-ESAIADVSWHMKNENLFGSAGEDGRLVIWDTRT-NQMQHQVKVHER 261 Query: 488 EILRPYECMDVSCNGIVLCTGSQLVDDDAYLVFFDQRKPKPLGGYWNSHTDDVTQIKSPR 667 E+ Y + N VL T S D+ + FD RK +SH +V Q++ Sbjct: 262 EV--NYLSFN-PFNEWVLATAS----SDSTVALFDLRKLNAPLHVMSSHEGEVFQVEWDP 314 Query: 668 LEWRSLXSGSLDGLINVYXIXXEXEE 745 L S D + V+ + EE Sbjct: 315 NHETVLASSGEDRRLMVWDLNRVGEE 340 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 36.3 bits (80), Expect = 0.026 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 2/156 (1%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA SD +++I+ + Q + GH T + F+P + + S GLD +VK+WD Sbjct: 115 LASGSSDANLKIWDIRKKGCIQTYK--GHSRGIST-IRFTP-DGRWVVSGGLDNVVKVWD 170 Query: 440 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDDAYLVFFDQRKPKPLGG 619 + A G + E+K E P +D +L TGS D + F+D + +G Sbjct: 171 LTA-GKLLHEFKFHE----GPIRSLDFHPLEFLLATGSA----DRTVKFWDLETFELIG- 220 Query: 620 YWNSHTDDVTQIKSPRL--EWRSLXSGSLDGLINVY 721 S + T ++S + + R+L G LD + VY Sbjct: 221 ---STRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY 252 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +2 Query: 335 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 L GH++ ++ V +S + +LY+ G DG ++ WDIR G Sbjct: 186 LSGHRDGVMS-VEWSTSSEWVLYTGGCDGAIRFWDIRRAG 224 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +2 Query: 335 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 L GH++ ++ V +S + +LY+ G DG ++ WDIR G Sbjct: 186 LSGHRDGVMS-VEWSTSSEWVLYTGGCDGAIRFWDIRRAG 224 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 35.9 bits (79), Expect = 0.035 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKE-ATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 D + +Y + QV + HG E +T + FS L + +WD G Sbjct: 207 DGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLG- 265 Query: 455 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 VL+ +++ C+ +S +G LCTGS Sbjct: 266 EVVLDLGLQQDSHRNRISCLGLSADGSALCTGS 298 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 35.9 bits (79), Expect = 0.035 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKE-ATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 D + +Y + QV + HG E +T + FS L + +WD G Sbjct: 269 DGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLG- 327 Query: 455 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 VL+ +++ C+ +S +G LCTGS Sbjct: 328 EVVLDLGLQQDSHRNRISCLGLSADGSALCTGS 360 >At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 825 Score = 35.5 bits (78), Expect = 0.046 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = +2 Query: 236 LDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGL 415 L +KS +L S D ++ ++ LS + +V H + +T + F+P +DN S L Sbjct: 474 LSWSKSQHLLSSSMDKTVRLWDLSSKTCLKV---FSHSDY-VTCIQFNPVDDNYFISGSL 529 Query: 416 DGLVKLWDI 442 D V++W I Sbjct: 530 DAKVRIWSI 538 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 35.5 bits (78), Expect = 0.046 Identities = 30/98 (30%), Positives = 45/98 (45%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA SD ++ ++ Q + GH T + FSP + + S GLD +VK+WD Sbjct: 64 LASGSSDTNLRVWDTRKKGCIQTYK--GHTRGIST-IEFSP-DGRWVVSGGLDNVVKVWD 119 Query: 440 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 + A G + E+K E P +D +L TGS Sbjct: 120 LTA-GKLLHEFKCHE----GPIRSLDFHPLEFLLATGS 152 Score = 30.3 bits (65), Expect = 1.7 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 4/135 (2%) Frame = +2 Query: 335 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECM 514 L GH + + V F+ E+ L+ + G++KLWD+ EE +++R + Sbjct: 3 LCGHT-SPVDSVAFN-SEEVLVLAGASSGVIKLWDL------------EESKMVRAFTGH 48 Query: 515 DVSCNGIVLCTGSQLV---DDDAYLVFFDQRKPKPLGGYWNSHTDDVTQIK-SPRLEWRS 682 +C+ + + + D L +D RK + Y HT ++ I+ SP W Sbjct: 49 RSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTY-KGHTRGISTIEFSPDGRW-- 105 Query: 683 LXSGSLDGLINVYXI 727 + SG LD ++ V+ + Sbjct: 106 VVSGGLDNVVKVWDL 120 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +2 Query: 374 FSPKEDNLLYSTGLDGLVKLWDIRAGG-SCVLEYKDEEEEILR--PYECMDVSCNGIVLC 544 FSP + L S+ +DG +++WD +G L+Y+ +E ++ P C+D S + +L Sbjct: 221 FSP-DGQFLASSSVDGFIEVWDYISGKLKKDLQYQADESFMMHDDPVLCIDFSRDSEMLA 279 Query: 545 TGSQ 556 +GSQ Sbjct: 280 SGSQ 283 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 34.7 bits (76), Expect = 0.080 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +2 Query: 338 HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMD 517 HGH++ T+ V FSP S G D + LWD R G + V + + + L C+D Sbjct: 289 HGHED-TVEDVAFSPTSAQEFCSVGDDSCLILWDARTGTNPVTKVEKAHDADL---HCVD 344 Query: 518 VS-CNGIVLCTGSQLVDDDAYLVFFDQRK 601 + + ++ TGS D + FD+RK Sbjct: 345 WNPHDDNLILTGSA----DNTVRLFDRRK 369 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = +2 Query: 275 SDNSIEIY---KLSDSSLHQ-VCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 +DN++ ++ KL+ + + + + GHK A L V +SP + ++ S+ DGL+ +WD Sbjct: 358 ADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLC-VQWSPDKSSVFGSSAEDGLLNIWD 415 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 34.7 bits (76), Expect = 0.080 Identities = 20/61 (32%), Positives = 34/61 (55%) Frame = +2 Query: 311 SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEE 490 S+ + V +++GHK T + FSP + L + G DG+VK+W I S + + ++E Sbjct: 186 SAAYMVQKINGHKGKIWT-LKFSP-DGKYLATGGEDGVVKIWRITLSDSLLASFLRQQEP 243 Query: 491 I 493 I Sbjct: 244 I 244 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRL-HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 LA+SL++NS+E Y L S + + H + + V S EDN L + VK+W Sbjct: 375 LALSLNNNSLEFYSLKSSENAKTVTIEHQGHRSDVRSVTLS--EDNTLLMSTSHSEVKIW 432 Query: 437 DIRAGGSCV 463 + + GSC+ Sbjct: 433 N-PSTGSCL 440 Score = 29.1 bits (62), Expect = 4.0 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 5/137 (3%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 D +++I+ L H+ HG + V + + L+S G D LVK WD Sbjct: 603 DKNLKIWGLDFGDCHKSIFAHGDSVMGVKFV----RNTHYLFSIGKDRLVKYWDADK-FE 657 Query: 458 CVLEYKDEEEEILRPYECMDVSCNGIVLCTGS-----QLVDDDAYLVFFDQRKPKPLGGY 622 +L + EI C+ +S G L TGS + D F ++ K K L Sbjct: 658 HLLTLEGHHAEIW----CLAISNRGDFLVTGSHDRSMRRWDRSEEPFFLEEEKEKRLEEL 713 Query: 623 WNSHTDDVTQIKSPRLE 673 + S D+ + +E Sbjct: 714 FESEIDNAADDRHGPME 730 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 D +I+++ L + L + L H ++ + + D L S LD VK+W GG+ Sbjct: 293 DKTIKVWSLDN--LQCIQTLTDHSSVVMSLICW----DQFLLSCSLDNTVKIWAAIEGGN 346 Query: 458 CVLEYKDEEEE-ILRPYECMDVSCNGIVLC 544 + Y +EE +L D ++LC Sbjct: 347 LEVTYTHKEEHGVLALCGVHDAEAKPVLLC 376 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 33.5 bits (73), Expect = 0.19 Identities = 27/95 (28%), Positives = 46/95 (48%) Frame = +2 Query: 275 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 SD I Y L+ ++ + R H + + T +V+S ++ ++ STG D +K WD R Sbjct: 73 SDGFIRRYDLNAGTVDTIGR---HDDIS-TSIVYSYEKGEVI-STGFDEKIKFWDTRQRE 127 Query: 455 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQL 559 S V D + C+ VS N +V+C + + Sbjct: 128 SLVFS-TDAGGAV----GCVTVSGNNLVVCVDASM 157 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 33.5 bits (73), Expect = 0.19 Identities = 27/95 (28%), Positives = 46/95 (48%) Frame = +2 Query: 275 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 SD I Y L+ ++ + R H + + T +V+S ++ ++ STG D +K WD R Sbjct: 73 SDGFIRRYDLNAGTVDTIGR---HDDIS-TSIVYSYEKGEVI-STGFDEKIKFWDTRQRE 127 Query: 455 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQL 559 S V D + C+ VS N +V+C + + Sbjct: 128 SLVFS-TDAGGAV----GCVTVSGNNLVVCVDASM 157 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.5 bits (73), Expect = 0.19 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 359 LTQVVFSPKEDNLLYSTGLDGLVKLWDI 442 +T V F+P +DN S +DG V++WD+ Sbjct: 365 VTCVAFNPVDDNYFISGSIDGKVRIWDV 392 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.5 bits (73), Expect = 0.19 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 359 LTQVVFSPKEDNLLYSTGLDGLVKLWDI 442 +T V F+P +DN S +DG V++WD+ Sbjct: 365 VTCVAFNPVDDNYFISGSIDGKVRIWDV 392 >At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus];Human (H326) translated mRNA - Homo sapiens, EMBL:HS06631 Length = 481 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/76 (23%), Positives = 38/76 (50%) Frame = +2 Query: 245 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 424 T + S +D + + ++ ++ + RL G + ++ P + N+ YS G DG Sbjct: 110 TDDRTIITSGADGQVRLGQILENGKVETKRL-GRHHGRVYKLAVLPGDPNVFYSCGEDGF 168 Query: 425 VKLWDIRAGGSCVLEY 472 V+ +DIR+ + ++ Y Sbjct: 169 VQHFDIRSNSATMVLY 184 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +2 Query: 245 TKSLNLAISLSDNSIEIYKLSDSSLHQVC-RLHGHKEATLTQVVFSPKEDNLLYSTGLDG 421 +KS +L S D ++ ++ LS Q C ++ H + +T + F+P +D S LD Sbjct: 522 SKSQHLLSSSMDKTVRLWNLSS----QTCLKVFSHSDY-VTCIQFNPVDDRYFISGSLDA 576 Query: 422 LVKLWDI 442 V++W I Sbjct: 577 KVRVWSI 583 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/86 (25%), Positives = 42/86 (48%) Frame = +2 Query: 236 LDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGL 415 L +KS L S D ++ ++ + + +L H + +T + FSP ++N S L Sbjct: 512 LSWSKSQLLLSSSMDKTVRLWDIETKTC---LKLFAHNDY-VTCIQFSPVDENYFLSGSL 567 Query: 416 DGLVKLWDIRAGGSCVLEYKDEEEEI 493 D +++W I+ V+E+ D E + Sbjct: 568 DAKIRIWSIQ--DRHVVEWSDLHEMV 591 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 33.1 bits (72), Expect = 0.25 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 D +++++ LS+ L L GH T V SP + +L S G DG+V LWD+ G Sbjct: 173 DKTVKVWNLSNCKLRST--LAGHTGYVST-VAVSP-DGSLCASGGKDGVVLLWDLAEG 226 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = +2 Query: 257 NLAISLS-DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 N +S S D ++ ++K+ + V + + +T V F+P +N S +DG V++ Sbjct: 340 NYLLSASMDKTVRLWKVGSNDCLGVFAHNSY----VTSVQFNPVNENYFMSGSIDGKVRI 395 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 W+I G V+++ D ++ I Sbjct: 396 WNI--SGCSVVDWADLKDII 413 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 32.7 bits (71), Expect = 0.32 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +2 Query: 338 HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMD 517 +GHK+ T+ V F P S G D + LWD R G S ++ + + L C+D Sbjct: 278 NGHKD-TVEDVAFCPSSAQEFCSVGDDSCLMLWDARTGTSPAMKVEKAHDADL---HCVD 333 Query: 518 VS--CNGIVLCTGS 553 + N ++L TGS Sbjct: 334 WNPHDNNLIL-TGS 346 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = +2 Query: 275 SDNSIEIY---KLSDSSLHQ-VCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 +DN++ ++ L+ + + V + GH+ A L V +SP + ++ S+ DGL+ +WD Sbjct: 347 ADNTVRVFDRRNLTSNGVGSPVYKFEGHRAAVLC-VQWSPDKSSVFGSSAEDGLLNIWD 404 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 32.7 bits (71), Expect = 0.32 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 1/100 (1%) Frame = +2 Query: 257 NLAISLS-DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 N+ +S S D ++ I+ ++ +V H +T V F+ ++ +L+ S+ DGL ++ Sbjct: 126 NMIVSGSFDETVRIWDVTTGKCLKVLPAHSDP---VTAVDFN-RDGSLIVSSSYDGLCRI 181 Query: 434 WDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 WD G CV D+E P + S NG + G+ Sbjct: 182 WD-SGTGHCVKTLIDDENP---PVSFVRFSPNGKFILVGT 217 >At4g35370.1 68417.m05025 transducin family protein / WD-40 repeat family protein contains 4 (3 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 414 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +2 Query: 257 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 + +SL D +++ + S L +H H ++ ++ + ++ NLL + D VKLW Sbjct: 315 SFVVSLKDGTVKGFDTRASDLSPSFIIHAH-DSEVSSISYNIHAPNLLATGSADESVKLW 373 Query: 437 DI 442 D+ Sbjct: 374 DL 375 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 D +++++ L + L L GH L V SP + +L S G DG++ LWD+ G Sbjct: 172 DKTVKVWNLQNCKLRNT--LAGHS-GYLNTVAVSP-DGSLCASGGKDGVILLWDLAEG 225 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 32.3 bits (70), Expect = 0.43 Identities = 28/97 (28%), Positives = 45/97 (46%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA S D +++++ + + + L+GH A + +V FSP +L+ S D V LWD Sbjct: 208 LATSSVDKTVKVWDVRSYRV-PLAVLNGHGYA-VRKVKFSPHRRSLIASCSYDMSVCLWD 265 Query: 440 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTG 550 + V Y D E + M V G++ TG Sbjct: 266 YMVEDALVGRY-DHHTEFAVGID-MSVLVEGLMASTG 300 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/63 (20%), Positives = 35/63 (55%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 D++++++ + + + + H + + Q V++PK ++ S D +++WD+R GS Sbjct: 128 DDTVKLWAMDRPASVRTFKEHAY---CVYQAVWNPKHGDVFASASGDCTLRIWDVREPGS 184 Query: 458 CVL 466 ++ Sbjct: 185 TMI 187 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 31.9 bits (69), Expect = 0.57 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 4/100 (4%) Frame = +2 Query: 368 VVFSPKEDNLLYSTGLDGLVKLWD--IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVL 541 V FSP + ++ S G+D + +D R SC+ Y+ P+ + NG +L Sbjct: 228 VCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCI-AYE-------APFSSLAFGDNGYIL 279 Query: 542 CTGSQLVDDDAYLVFFDQR-KPKPLGG-YWNSHTDDVTQI 655 G+ + +VF+D R KP+P+ + S+++DVT + Sbjct: 280 VAGT----SNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSL 315 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%) Frame = +2 Query: 221 SYIHRLDGTKSLNLAIS---LSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED 391 S+ LD L+ + S LS + + +L D +L H + +T V F+P ++ Sbjct: 514 SFTGHLDDVLDLSWSRSQLLLSSSMDKTVRLWDIETQSCLKLFAHNDY-VTCVQFNPLDE 572 Query: 392 NLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEI 493 + S LD +++W+I V+E+ D +E + Sbjct: 573 DYFISGSLDAKIRIWNI--SNRQVVEWNDLKEMV 604 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 31.9 bits (69), Expect = 0.57 Identities = 29/106 (27%), Positives = 52/106 (49%) Frame = +2 Query: 404 STGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDDAYLV 583 S+G D L ++WD+R + +L ++ +++L +D S NG L +G +D Sbjct: 147 SSGFDSLARVWDLRTARN-ILIFQGHIKQVL----SVDFSPNGYHLASGG----EDNQCR 197 Query: 584 FFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWRSLXSGSLDGLINVY 721 +D R K L +H + V+Q+K E L + S D +N++ Sbjct: 198 IWDLRMRKLL-YIIPAHVNLVSQVKYEPQERYFLATASHDMNVNIW 242 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 320 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 +++ L GHKE +T VVFS +D L + D K+W Sbjct: 97 NKIVVLKGHKEH-VTDVVFSSVDDECLATASTDRTEKIW 134 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = +2 Query: 257 NLAISLSDNSIEIYKLSDSSL-----HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 421 + +SL D +++ + + +S+ + ++GH EA T V ++ NLL + D Sbjct: 334 SFVVSLEDGTVKGFDVRQASISASESNPSFTINGHDEAA-TSVSYNISAPNLLATGSKDR 392 Query: 422 LVKLWDI 442 VKLWD+ Sbjct: 393 TVKLWDL 399 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA D +++++ LS++ + H L + FSP LL G+ G +KLWD Sbjct: 385 LATGSKDRTVKLWDLSNNEPSCIAT-HNPNAGGLFFIAFSPDNPFLLAMGGVMGELKLWD 443 Query: 440 IRAGGSCVLEYKDEE 484 + + Y E Sbjct: 444 TLSDTNVSSRYGSRE 458 Score = 28.3 bits (60), Expect = 7.0 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 6/111 (5%) Frame = +2 Query: 392 NLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGI---VLCTGSQLV 562 N+L S D VK+WD+ A G+C + + +E+ V+ N VL +GS Sbjct: 247 NILASASADKKVKVWDV-ATGTCKITMEHHTKEV------QAVAWNHYAPEVLLSGS--- 296 Query: 563 DDDAYLVFFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWR---SLXSGSLDG 706 D +V D R+P G W+ +D + P E SL G++ G Sbjct: 297 -FDQTVVLKDGRQPSHSGFKWSVMSDVESLAWDPHSEHSFVVSLEDGTVKG 346 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +2 Query: 278 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 D +++++ L + L L GH L V SP + +L S G DG++ LWD+ G Sbjct: 172 DKTVKVWNLQNCKLRN--SLVGHS-GYLNTVAVSP-DGSLCASGGKDGVILLWDLAEG 225 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 L +S + + I +Y S L Q + H P + + + G D L+K+WD Sbjct: 424 LGVSFTKHLIHVYAYQGSDLRQHLEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIKVWD 483 Query: 440 I 442 + Sbjct: 484 L 484 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 290 EIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED-NLLYSTGLDGLVKLW 436 ++ K+ D S ++ GH EA + + KE+ ++ST LDG +K W Sbjct: 477 KLIKVWDLSGKKLFTFEGH-EAPVYSICPHQKENIQFIFSTALDGKIKAW 525 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 31.5 bits (68), Expect = 0.75 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 1/115 (0%) Frame = +2 Query: 212 LLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED 391 ++ S R DG +L A LS ++++ + + + R H + + V P +D Sbjct: 95 VVSSVCFRSDG--ALFAACDLS-GVVQVFDIKERMALRTLRSH----SAPARFVKYPVQD 147 Query: 392 NL-LYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 L L S G DG+VK WD+ G+ V+ ++ +R +C V N +L TGS Sbjct: 148 KLHLVSGGDDGVVKYWDV--AGATVISDLLGHKDYVRCGDCSPV--NDSMLVTGS 198 >At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; similar to "Will die slowly" protein, Drosophia; putative cdc20 protein - Arabidopsis thaliana, EMBL:AF029262 Length = 411 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/80 (26%), Positives = 42/80 (52%) Frame = +2 Query: 254 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 L+LAI L ++ ++++ + QV L G E+ + + ++ +++L + G+DG + Sbjct: 147 LDLAIGLDNSEVQLWDCVSN--RQVRTLRGGHESRVGSLAWN---NHILTTGGMDGKIVN 201 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 D+R S V Y EE+ Sbjct: 202 NDVRIRSSIVETYLGHTEEV 221 >At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = +2 Query: 254 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 L+LA+ L ++ ++++ + QV L G E+ + + + ++++L + G+DG + Sbjct: 181 LDLAVGLDNSEVQLWDCVSN--RQVRTLRGGHESRVGSLAW---DNHILTTGGMDGKIVN 235 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 D+R S V Y EE+ Sbjct: 236 NDVRIRSSIVETYLGHTEEV 255 >At5g12920.1 68418.m01482 expressed protein contains 3 weak WD-40 repeats (PF00400); low similarity to MEK kinase alpha (GI:4028547); transcriptional repressor TUP1 (GI:3406654) [Dictyostelium discoideum]; Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) (SP:Q38884) [Arabidopsis thaliana] Length = 442 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 359 LTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILR 499 L+ V + ED+ ++S G+V +WD RAG S +E + + ++ Sbjct: 153 LSDVAITSDEDSRIFSPDTLGMVHVWDRRAGVSPCIELSTDRYDSIK 199 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 +A + +I+++ L ++ + V L GH+ ++ V F P + S LD +K+WD Sbjct: 74 VAAGAASGTIKLWDLEEAKI--VRTLTGHRSNCIS-VDFHPFGE-FFASGSLDTNLKIWD 129 Query: 440 IRAGGSCVLEYK 475 IR G C+ YK Sbjct: 130 IRKKG-CIHTYK 140 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 +A + +I+++ L ++ + V L GH+ ++ V F P + S LD +K+WD Sbjct: 74 VAAGAASGTIKLWDLEEAKI--VRTLTGHRSNCIS-VDFHPFGE-FFASGSLDTNLKIWD 129 Query: 440 IRAGGSCVLEYK 475 IR G C+ YK Sbjct: 130 IRKKG-CIHTYK 140 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 30.7 bits (66), Expect = 1.3 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 4/107 (3%) Frame = +2 Query: 137 DTVEPEELEQMFSKKYKI----VTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKL 304 D ++L+ + KK+ T H SL+ S + L+ T +S+ DN I Y Sbjct: 52 DIANAKQLKITYHKKHGTDRVCFTHHPSSLICSSRYNLESTGESLRYLSMYDNRILRY-- 109 Query: 305 SDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIR 445 GHK+ ++ + SP D+ + S LD V+LWD+R Sbjct: 110 ----------FKGHKDRVVS-LCMSPINDSFM-SGSLDRSVRLWDLR 144 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/79 (30%), Positives = 41/79 (51%) Frame = +2 Query: 239 DGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLD 418 D ++ L +A + +I+++ L ++ + V L GH+ + V F P + S LD Sbjct: 161 DASEGL-VAAGAASGTIKLWDLEEAKV--VRTLTGHR-SNCVSVNFHPFGE-FFASGSLD 215 Query: 419 GLVKLWDIRAGGSCVLEYK 475 +K+WDIR G C+ YK Sbjct: 216 TNLKIWDIRKKG-CIHTYK 233 >At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 494 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 8/81 (9%) Frame = +2 Query: 257 NLAISLSDNSIEIYKL------SDSSLHQVCRLHGH-KEATLTQVVFSPKEDNLLYSTGL 415 + +SL D +++ + + SDS L+ + H ++ ++ + ++ NLL + + Sbjct: 366 SFVVSLEDGTVKGFDIRAAQSGSDSDLNPTYTIQAHAQDRGVSSISYNISTPNLLATGSM 425 Query: 416 DGLVKLWDIRAG-GSCVLEYK 475 D VKLWD+ SC+ ++ Sbjct: 426 DKSVKLWDLSNNEPSCIATHQ 446 Score = 29.5 bits (63), Expect = 3.0 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 6/127 (4%) Frame = +2 Query: 344 HKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVS 523 H E+ L + ++ + N+L S D VK+WD+ A G+C + + +E+ V+ Sbjct: 264 HTESVLG-LAWNKEFRNILASASADKKVKVWDV-ATGTCKITMEHHTKEV------QAVA 315 Query: 524 CNGI---VLCTGSQLVDDDAYLVFFDQRKPKPLGGYWNSHTDDVTQIKSPRLEWR---SL 685 N VL +GS D +V D R+P G W+ +D + P E SL Sbjct: 316 WNHYAPEVLLSGS----FDQTVVMKDGRQPSHSGFKWSVMSDVESLAWDPHCEHSFVVSL 371 Query: 686 XSGSLDG 706 G++ G Sbjct: 372 EDGTVKG 378 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 209 SLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKE 388 SL+ HR++G LA D I +Y + +L V GH + +T + FS ++ Sbjct: 517 SLVKIVYHRVNGL----LATVADDFVIRLYDVV--TLKMVREFRGHTDR-ITDLCFS-ED 568 Query: 389 DNLLYSTGLDGLVKLWDI 442 + S+ +DG +++WD+ Sbjct: 569 GKWVISSSMDGSLRIWDV 586 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 30.7 bits (66), Expect = 1.3 Identities = 39/151 (25%), Positives = 63/151 (41%), Gaps = 6/151 (3%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDS--SLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 +A + D SI+I+ L S + H + +T V FS + +L S DG +K+ Sbjct: 342 IAGGVGDGSIQIWSLKPGWGSRPDIYVGKAHTD-DITSVKFS-SDGRILLSRSFDGSLKV 399 Query: 434 WDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDD---AYLVFFDQRKP 604 WD+R + + E P + S + ++ TG+ + D L F+D+ K Sbjct: 400 WDLRQMKEALKVF--EGLPNYYPQTNVAFSPDEQIILTGTSVEKDSTTGGLLCFYDRTKL 457 Query: 605 KPLGGYWNSHTDDVTQIK-SPRLEWRSLXSG 694 + + S T V Q PRL SG Sbjct: 458 EIVQKVGISPTSSVVQCAWHPRLNQIFATSG 488 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +2 Query: 335 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 442 L GH +A +T + +S +LL S GLDG V +W++ Sbjct: 156 LTGHTKA-VTAIDWSTSHVHLLASAGLDGAVYVWNV 190 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 347 KEATLTQVV-FSPKEDNLLYSTGLDGLVKLWDIRA 448 KE + VV F P N+ S G G ++LWDIRA Sbjct: 244 KEDEVVGVVKFHPDNCNVFLSGGSKGSLRLWDIRA 278 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 L + D +I+++ + ++ V L GH T+ + P +LL S DG LWD Sbjct: 143 LLTASGDQTIKVWDVEENKCTGV--LIGHT-GTVKSMCSHPTNSDLLVSGSRDGCFALWD 199 Query: 440 IRAGGS 457 +R S Sbjct: 200 LRCKSS 205 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +2 Query: 185 KIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQ-VCRLHGHKEATL 361 KI T H+ +H + G + +A + SD +I+I +S+S Q + L GH+ + Sbjct: 5 KIETGHS-DTIHDVVMDYYGKR---VATASSDCTIKITGVSNSGGSQHLATLTGHR-GPV 59 Query: 362 TQVVFS-PKEDNLLYSTGLDGLVKLW 436 QV ++ PK +LL S DG + LW Sbjct: 60 WQVAWAHPKFGSLLASCSYDGQIILW 85 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 30.3 bits (65), Expect = 1.7 Identities = 33/156 (21%), Positives = 62/156 (39%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA DN ++++ + + H + +T + F +LL S LDG V+ WD Sbjct: 364 LATGADDNKVKVWNVMSGTCFITFTEHTN---AVTALHFMADNHSLL-SASLDGTVRAWD 419 Query: 440 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDDAYLVFFDQRKPKPLGG 619 + YK R + + +G V+C G+ D++ +F +K + Sbjct: 420 FKR----YKNYKTYTTPTPRQFVSLTADPSGDVVCAGTL----DSFEIFVWSKKTGQIKD 471 Query: 620 YWNSHTDDVTQIKSPRLEWRSLXSGSLDGLINVYXI 727 + H V + L + L S S D + ++ + Sbjct: 472 ILSGHEAPVHGLMFSPLT-QLLASSSWDYTVRLWDV 506 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 30.3 bits (65), Expect = 1.7 Identities = 33/156 (21%), Positives = 62/156 (39%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA DN ++++ + + H + +T + F +LL S LDG V+ WD Sbjct: 404 LATGADDNKVKVWNVMSGTCFITFTEHTN---AVTALHFMADNHSLL-SASLDGTVRAWD 459 Query: 440 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDDAYLVFFDQRKPKPLGG 619 + YK R + + +G V+C G+ D++ +F +K + Sbjct: 460 FKR----YKNYKTYTTPTPRQFVSLTADPSGDVVCAGTL----DSFEIFVWSKKTGQIKD 511 Query: 620 YWNSHTDDVTQIKSPRLEWRSLXSGSLDGLINVYXI 727 + H V + L + L S S D + ++ + Sbjct: 512 ILSGHEAPVHGLMFSPLT-QLLASSSWDYTVRLWDV 546 >At5g50970.1 68418.m06321 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 512 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +2 Query: 320 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 H ++ + L ++ P + L ++ LDG+V LW ++ G Sbjct: 186 HTSNQISSQHKRKLRSLILCPVNEQLFATSSLDGMVSLWQLQPG 229 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +2 Query: 320 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVL--EYKDEEEEI 493 H + + + + + S +LL+S G DG + +W+ GG V+ + E + Sbjct: 249 HSLVAILSEHNSGINALALSGTNGSLLHSGGSDGSILVWERDDGGDIVVVGMLRGHTESV 308 Query: 494 LRPYECMDVSCNG 532 L D+ C+G Sbjct: 309 LCLAVVSDILCSG 321 >At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 protein (ZFWD4) contains 6 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd4 protein (GI:12057170) [Arabidopsis thaliana] Length = 419 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 317 LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCV 463 L V L GH + + + P+ + L+S +DG +++WD + G CV Sbjct: 121 LAMVASLEGHNKEL--KGIALPEGSDKLFSVSIDGTLRVWDCNS-GQCV 166 >At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 protein (ZFWD3) contains 5 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd3 protein (GP:12057168) {Arabidopsis thaliana} Length = 472 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = +2 Query: 227 IHRLDGTKSLNLAISLSDNSIEIYKLSDSS---LHQVCRLHGHKEATLTQVVFSPKEDNL 397 +H + + A S SI ++K +DS + L GH +T V + + Sbjct: 269 VHAMTAANGMLFA-GTSSGSILVWKATDSESDPFKYLTSLEGHHSGEVTCFVVGGE---V 324 Query: 398 LYSTGLDGLVKLWDI 442 LYS +D +K+WD+ Sbjct: 325 LYSGSVDKTIKVWDL 339 >At4g23890.1 68417.m03436 expressed protein hypothetical protein, Synechocystis sp., PIR:S76577 Length = 250 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 344 HKEATLTQVVFSP-KEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYE 508 H+ +T+ + VF P K+ + LY G LW++ G K E+E+ R E Sbjct: 25 HQFSTVNRSVFPPPKQQSKLYQVKAMGKFNLWEVMGGRGLCNGEKGIEKELQRNIE 80 >At4g07410.1 68417.m01136 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400) (2 weak); similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 815 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRL--HGHKEATLTQVVF--SPK---EDNLLYSTGLD 418 +A + D S+EI+ +S ++ C+L HG + ++ + + SP L+S+ +D Sbjct: 28 VAAAREDGSLEIWLVSPGAVGWHCQLTIHGDPNSRISSLAWCCSPSIGLPSGRLFSSSID 87 Query: 419 GLVKLWDI 442 G + WD+ Sbjct: 88 GSISEWDL 95 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 LA + D + +Y++S+ R V +SP + ++S DGL++ WD Sbjct: 168 LAAACDDGCVRLYRISNLEKLTYYRSLPRVSGRALSVTWSP-DAKRIFSGSSDGLIRCWD 226 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/84 (23%), Positives = 38/84 (45%) Frame = +2 Query: 224 YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLY 403 +++RL+ T ++ + I ++ L + H R + V F +++Y Sbjct: 42 HVNRLELTPEKGKLVAACNPHIRLFDLRSYNPHIPVRNFVSHTKNVMAVGFQ-YTGHMMY 100 Query: 404 STGLDGLVKLWDIRAGGSCVLEYK 475 S DG VK+WD+R C E++ Sbjct: 101 SGSEDGSVKIWDLRV-RECQREFR 123 >At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 877 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +2 Query: 293 IYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLV--KLWDIRAGGSCVL 466 IY L +H VC + + V+ N +Y T D L+ + WD+ A G Sbjct: 152 IYTLRSDKVH-VCLVDKERGTPFLSVLELRLLKNNIYETASDSLMLYRRWDLGATGDLPA 210 Query: 467 EYKDE 481 YKD+ Sbjct: 211 RYKDD 215 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 29.9 bits (64), Expect = 2.3 Identities = 27/107 (25%), Positives = 50/107 (46%) Frame = +2 Query: 143 VEPEELEQMFSKKYKIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLH 322 VE E L+ + +K +V ++ ++ DG LA + D++++I Sbjct: 84 VEAESLQHLSAKYCPLVPPPRSTIAAAFSS--DGR---TLASTHGDHTVKIIDCETGKCL 138 Query: 323 QVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCV 463 ++ L GH+ T V F P+ ++ S LD V+LW+ + G C+ Sbjct: 139 KI--LTGHRR-TPWVVRFHPRHSEIVASGSLDHEVRLWNAKT-GECI 181 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 29.9 bits (64), Expect = 2.3 Identities = 27/107 (25%), Positives = 50/107 (46%) Frame = +2 Query: 143 VEPEELEQMFSKKYKIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLH 322 VE E L+ + +K +V ++ ++ DG LA + D++++I Sbjct: 84 VEAESLQHLSAKYCPLVPPPRSTIAAAFSS--DGR---TLASTHGDHTVKIIDCETGKCL 138 Query: 323 QVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCV 463 ++ L GH+ T V F P+ ++ S LD V+LW+ + G C+ Sbjct: 139 KI--LTGHRR-TPWVVRFHPRHSEIVASGSLDHEVRLWNAKT-GECI 181 >At5g58760.1 68418.m07360 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); damage-specific DNA binding protein 2 (GI:10798819) [Homo sapiens] Length = 557 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 374 FSPKEDNLLYSTGLDGLVKLWDIRAGGSCVL 466 FSP D+++YS DG + D+ G S L Sbjct: 223 FSPTNDDMVYSASSDGTIGYTDLETGTSSTL 253 >At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; Length = 466 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = +2 Query: 254 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 L+LA+ L ++ ++++ + QV L G E+ + + ++ +++L + G+DG + Sbjct: 178 LDLAVGLDNSEVQLWDFVSN--RQVRTLIGGHESRVGSLAWN---NHILTTGGMDGKIVN 232 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 D+R S V Y EE+ Sbjct: 233 NDVRIRSSIVGTYLGHTEEV 252 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +2 Query: 275 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIR 445 SD+SI +Y L + + R H T V F+ + NL+ S D L K+WD R Sbjct: 249 SDDSIYVYDLEANRVS--LRTVAHTSDVNT-VCFADESGNLILSGSDDNLCKVWDRR 302 >At1g80710.1 68414.m09470 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); similar to damage-specific DNA-binding protein 2 (DDB2) [Mus musculus] Length = 516 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +2 Query: 350 EATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 457 E + + F+P+ +++ ++ DG LWD+R+ G+ Sbjct: 348 ERRINSIDFNPQNPHVMATSSTDGTACLWDLRSMGA 383 >At5g37560.1 68418.m04523 zinc finger protein-related contains weak similarity to zinc fingers and Pfam:PF01485 IBR domain Length = 408 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +2 Query: 317 LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEIL 496 L +V RL G +T T V+ + ++DN +D LVK + + K + E +L Sbjct: 120 LEEVQRLRGRLASTGT-VLVATRDDNFALRLAIDALVKATQEKPLTCSICSDKTDAEHML 178 Query: 497 RPYECMDVSC 526 +C+ C Sbjct: 179 LNDKCLHRHC 188 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +2 Query: 245 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 424 +K+ L + DNS+ ++++ + H +T V F+P +D+ S +DG Sbjct: 365 SKNNRLLSASVDNSVRLWQIG---CEDCLGIFSHNNY-VTSVQFNPVDDDHFISGSIDGK 420 Query: 425 VKLW 436 V++W Sbjct: 421 VRIW 424 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +2 Query: 245 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 424 +K+ L + DNS+ ++++ + H +T V F+P +D+ S +DG Sbjct: 365 SKNNRLLSASVDNSVRLWQIG---CEDCLGIFSHNNY-VTSVQFNPVDDDHFISGSIDGK 420 Query: 425 VKLW 436 V++W Sbjct: 421 VRIW 424 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = +2 Query: 242 GTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 421 G K +A D+ + I+ S L + L GH A + V +SP ++L S DG Sbjct: 498 GYKQAFIASGSEDSQVYIWHRSTGKL--IVELPGHAGA-VNCVSWSPTNLHMLASASDDG 554 Query: 422 LVKLWDI 442 +++W + Sbjct: 555 TIRIWGL 561 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 392 NLLYSTGLDGLVKLWDIRAG 451 N L S+ DG+VKLWD+ G Sbjct: 767 NYLASSDYDGIVKLWDVTTG 786 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 + L SI + ++ ++L + R H + +T + F ++ +LL S LDG V +W Sbjct: 195 ICYGLKGGSIRVLNIN-TALRSLFRGHSQR---VTDMAFFAEDVHLLASVSLDGKVFVWK 250 Query: 440 IRAG 451 I G Sbjct: 251 ISEG 254 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 359 LTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 +T V FS D + ++ G+D VK+WD+R G Sbjct: 183 ITAVSFSDAADKI-FTGGVDNDVKVWDLRKG 212 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSS-LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 +A + SD +I+I +S++ Q+ L GH+ PK ++L S DG V LW Sbjct: 26 IATASSDCTIKITGVSNNGGSQQLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILW 85 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 29.1 bits (62), Expect = 4.0 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +2 Query: 272 LSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 451 L NS IY L ++C+L +EA + D ++Y+T +DG K DIRA Sbjct: 755 LKPNSY-IYGSIIGLLCRICKLAEAEEAFSEMIRQGILPDTVVYTTLIDGFCKRGDIRAA 813 Query: 452 GSCVLE 469 E Sbjct: 814 SKFFYE 819 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/80 (25%), Positives = 43/80 (53%) Frame = +2 Query: 254 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 433 L+LA+ L ++ ++++ S+ H V L G E+ + + ++ +++L + G+DG + Sbjct: 165 LDLAVGLDNSEVQVWDCV-SNRH-VRTLRGGHESRVGSLAWN---NHILTTGGMDGKIVN 219 Query: 434 WDIRAGGSCVLEYKDEEEEI 493 D+R S + Y EE+ Sbjct: 220 NDVRIRSSIIGTYVGHTEEV 239 >At3g26480.1 68416.m03301 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (5 copies, 2 below cutoff); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 764 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +2 Query: 281 NSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLL---YSTGLDGLVKLWDIRA 448 N++ +Y ++ ++ L H A +T V+ P D + +++ LDG +++W+ A Sbjct: 28 NTVSVYSVATGL--KITSLEDHT-APVTSVIVDPSSDETVSYCWTSSLDGKIRIWEFSA 83 >At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Rbap46 polypeptide (GI:9454362) [Gallus gallus] Length = 351 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/90 (16%), Positives = 45/90 (50%) Frame = +2 Query: 176 KKYKIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEA 355 K +++++ + +LHS +N + ++S++ + L + +++ + A Sbjct: 155 KSAEVLSKDSAGMLHSLSGGAWDPHDVNAVAATGESSVQFW-----DLRTMKKVNSIEHA 209 Query: 356 TLTQVVFSPKEDNLLYSTGLDGLVKLWDIR 445 + V ++PK +++L + + + +WD+R Sbjct: 210 HVRGVDYNPKREHILVTAEDESGIHVWDLR 239 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.3 bits (60), Expect = 7.0 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 5/110 (4%) Frame = +2 Query: 239 DGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDN-----LLY 403 D T SL LA D++ +I+ + S+ R H + T+ P +N L Sbjct: 457 DPTGSL-LASCSDDSTAKIWNIKQSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLA 515 Query: 404 STGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 553 S D VKLWD G + + E P + S NG + +GS Sbjct: 516 SASFDSTVKLWDAEL-GKMLCSFNGHRE----PVYSLAFSPNGEYIASGS 560 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +2 Query: 242 GTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 421 G S +A D+ + I+ L ++ +V L GH T+ V ++PK +L S D Sbjct: 452 GLDSSFIASGSEDSQVYIWNLKNTKPLEV--LSGHS-MTVNCVSWNPKNPRMLASASDDQ 508 Query: 422 LVKLW 436 +++W Sbjct: 509 TIRIW 513 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSD-SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 + ++ + + I++Y S + L Q + H A +P + + G D L+K+W Sbjct: 422 IGVAFTKHLIQLYAFSGPNDLRQHTEIDAHVGAVNDLAFANPNRQLCVITCGDDKLIKVW 481 Query: 437 DI 442 D+ Sbjct: 482 DV 483 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 260 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 439 +A S ++ L ++ R H + +T++V +P E +LL S+ LD +++WD Sbjct: 427 IAAGFSSGQCRLFDLRENGFISSWRAH---DGYVTKLV-AP-ESHLLVSSSLDKTLRIWD 481 Query: 440 IR 445 +R Sbjct: 482 LR 483 >At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 275 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 S N + ++ D + +Q+ E + + +S + LL S DG VKLW I G Sbjct: 551 SSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGV 610 Query: 455 S 457 S Sbjct: 611 S 611 >At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 275 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 454 S N + ++ D + +Q+ E + + +S + LL S DG VKLW I G Sbjct: 551 SSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGV 610 Query: 455 S 457 S Sbjct: 611 S 611 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/79 (20%), Positives = 44/79 (55%) Frame = +2 Query: 257 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 ++A+ L+++ ++++ +S Q+ L G ++ + + ++ +++L + G+DGL+ Sbjct: 196 HVAVGLNNSEVQLW--DSASNRQLRTLKGGHQSRVGSLAWN---NHILTTGGMDGLIINN 250 Query: 437 DIRAGGSCVLEYKDEEEEI 493 D+R V Y+ +E+ Sbjct: 251 DVRIRSPIVETYRGHTQEV 269 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/79 (20%), Positives = 44/79 (55%) Frame = +2 Query: 257 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 436 ++A+ L+++ ++++ +S Q+ L G ++ + + ++ +++L + G+DGL+ Sbjct: 186 HVAVGLNNSEVQLW--DSASNRQLRTLKGGHQSRVGSLAWN---NHILTTGGMDGLIINN 240 Query: 437 DIRAGGSCVLEYKDEEEEI 493 D+R V Y+ +E+ Sbjct: 241 DVRIRSPIVETYRGHTQEV 259 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 27.9 bits (59), Expect = 9.2 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = +2 Query: 260 LAISLSDNSIEIYKLS--DS----SLHQVCRLHGHKEATLTQVVFSPKEDN-LLYSTGLD 418 +A DN+I ++ S DS S + + + + E + V +SP E N LL S D Sbjct: 281 IASGAGDNAIRLFVDSKHDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGNRLLASASDD 340 Query: 419 GLVKLWDI 442 G+VK+W + Sbjct: 341 GMVKIWQL 348 >At2g24680.1 68415.m02947 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 851 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/68 (20%), Positives = 33/68 (48%) Frame = +2 Query: 311 SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEE 490 ++L ++ L ++ ++ K+ +L +G G+ + + G + LEY DE+E Sbjct: 147 NNLGEITLLGQNRMKWFAYLLSMSKDGSLALGSGWKGICEANGVNTGEAFTLEYIDEQET 206 Query: 491 ILRPYECM 514 + +C+ Sbjct: 207 AHKTSQCV 214 >At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 638 DDVTQIKSPRLEWRSLXSGSLDGLINVYXIXXEXEEDALLYSLN 769 D V R EW G I V I E+AL+YSLN Sbjct: 155 DRVAIFSDTRAEWFIAFQGCFRQSITVVTIYASLGEEALIYSLN 198 >At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 638 DDVTQIKSPRLEWRSLXSGSLDGLINVYXIXXEXEEDALLYSLN 769 D V R EW G I V I E+AL+YSLN Sbjct: 155 DRVAIFSDTRAEWFIAFQGCFRQSITVVTIYASLGEEALIYSLN 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,363,603 Number of Sequences: 28952 Number of extensions: 371266 Number of successful extensions: 1261 Number of sequences better than 10.0: 112 Number of HSP's better than 10.0 without gapping: 1113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1250 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -