BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K07 (847 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0365 - 43071448-43071568,43071673-43072514 31 1.2 07_01_0061 - 451093-451377,451501-451596,451714-451824 29 6.2 >01_07_0365 - 43071448-43071568,43071673-43072514 Length = 320 Score = 31.1 bits (67), Expect = 1.2 Identities = 25/68 (36%), Positives = 31/68 (45%) Frame = +2 Query: 329 ANTQQDPRSCLWTTATLPVTSETTASKLLPSARGQSLSGALQTSPGSSTRPKDSSLPTDI 508 +NT R C+ T+ L TT +P+A QSL G + SP P SS P D Sbjct: 121 SNTPPQHRRCM-TSFDLADYHRTTDPVPVPAAAQQSLIGIDEISP-----PPSSSSPDDT 174 Query: 509 LTILTTFK 532 T L T K Sbjct: 175 TTQLVTLK 182 >07_01_0061 - 451093-451377,451501-451596,451714-451824 Length = 163 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -2 Query: 639 GKDPXRXEFRLGPQVCGQFVPGSIV*ALF-TKLTLEILNVVRIVRISVGNDESFGRVDDP 463 G DP RLG Q V V ++ +LTL I+N + +++ V + ++F R D Sbjct: 25 GSDPY-VVLRLGKQKVKTSVKKKSVNPIWHEELTLSIMNPIAPIKLGVFDKDTFSRDDPM 83 Query: 462 GD 457 GD Sbjct: 84 GD 85 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,455,464 Number of Sequences: 37544 Number of extensions: 344628 Number of successful extensions: 804 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -