BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K06 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0213 + 20974712-20975413 33 0.39 11_04_0071 - 13165019-13165082,13165345-13165428,13166325-131665... 31 1.2 10_01_0065 + 845447-846187,846969-847193 29 6.3 05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28... 28 8.3 04_04_0154 - 23146445-23146535,23146689-23146795,23146933-231469... 28 8.3 03_02_0124 - 5749183-5749773,5750628-5751160,5751191-5753035,575... 28 8.3 >02_04_0213 + 20974712-20975413 Length = 233 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 324 ITKENEEESIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQLGVAALP 491 + +E EEE + E R +A EE W+DF D L ++ ++ Q A P Sbjct: 73 VDEEEEEERMDQLWERDRDARAGDEERMDLLWEDFNDELLLQLRRRQQQRAAAGTP 128 >11_04_0071 - 13165019-13165082,13165345-13165428,13166325-13166524, 13166756-13170655 Length = 1415 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 678 VVPLHPGMLQ-LLQGLGSWRIFQLSQAPKIDRIYFHSCTS 562 V +H +L LL L S IF +S +P++ + HSCTS Sbjct: 1179 VTHVHNELLPFLLSNLTSLSIFAISNSPELTSLVLHSCTS 1218 >10_01_0065 + 845447-846187,846969-847193 Length = 321 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 500 IPSFDENCVWNGIELCH 550 +PSFD VW G+E CH Sbjct: 138 LPSFDMEGVWRGMEECH 154 >05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-282089, 285368-285440,286193-286281,286665-286711,286805-286885, 287011-287179,287381-287600,287679-287744,288194-288310, 288591-288628,288935-289032 Length = 434 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/51 (43%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -3 Query: 432 PGSPATRTSWSPP--RLLSLDARAPGEFVSIPL--RSPS*YSRCTPIRLSW 292 PGSP R S SPP RL S +P P+ RSP R TP R W Sbjct: 308 PGSPIRRRSPSPPPRRLRSPRHLSPRRDRGSPIRRRSPLPRRRLTPPRRMW 358 >04_04_0154 - 23146445-23146535,23146689-23146795,23146933-23146993, 23147070-23147221,23147306-23147383,23147696-23147809, 23147880-23147956,23148128-23148194,23148341-23148406, 23148528-23148651,23148733-23148825,23149446-23149594, 23149681-23149761,23150502-23150644,23150758-23150872 Length = 505 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 675 VPLHPGMLQLLQGLGSWRIFQLSQAPKIDRIYFHSCT 565 + L PG+L ++ GLG+ L+ P +D+I F T Sbjct: 206 IGLPPGVLNIITGLGTEAGAPLASHPHVDKIAFTGST 242 >03_02_0124 - 5749183-5749773,5750628-5751160,5751191-5753035, 5753632-5753820,5753911-5754013,5754087-5754269, 5754392-5754484,5755031-5755219,5756133-5756327 Length = 1306 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 207 DPDLEAREHEAREYMLHLDKTTGLRKN--RASLAEWEYTSNITKENEEESIQT 359 DP +E R ++ +DK+ + N R +LA +S+ITK +++ES+ + Sbjct: 511 DPSVEGYSRGRRTGVVEMDKSLKVDYNSRRNNLAPEVSSSHITKSSQDESVSS 563 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,804,573 Number of Sequences: 37544 Number of extensions: 414119 Number of successful extensions: 1210 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -