BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K06 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 29 0.24 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 2.2 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 9.0 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 28.7 bits (61), Expect = 0.24 Identities = 10/60 (16%), Positives = 28/60 (46%) Frame = +3 Query: 222 AREHEAREYMLHLDKTTGLRKNRASLAEWEYTSNITKENEEESIQTHLELSRQEKAAWEE 401 A + R ++ +D+ + L + A+W + +NI + E++ + ++ W++ Sbjct: 279 AETEKLRAFLTEIDRKSSLECSLNVAAQWNFETNINDATQVEALAAQQRYNDFQRLLWDQ 338 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.4 bits (53), Expect = 2.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +3 Query: 435 FTLRRMFKKYSQLGVAALPDGKFQALMRTVSGMESN 542 FT R++ +S++ +P G ++RT + E N Sbjct: 1030 FTFRQVAANFSEVFKKLVPQGNGHLILRTTNDQEGN 1065 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.4 bits (48), Expect = 9.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 566 RADLRSGIVRFHSRHSSHQSLE 501 RA++R+ + R RH HQ E Sbjct: 1087 RANIRARMARLRQRHRQHQQDE 1108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,206 Number of Sequences: 2352 Number of extensions: 13678 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -