BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K02 (850 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 3.8 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 5.1 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 24.6 bits (51), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 78 GGTDSARSHSATGAVQRTPGGHQ 146 GG+++ +H A G Q GG+Q Sbjct: 401 GGSNTPSNHGALGNTQNNAGGNQ 423 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.2 bits (50), Expect = 5.1 Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 6/108 (5%) Frame = +1 Query: 223 DASERQLVQSTVTALSDQFASVCSELEARQAAVEDACDAVARFLALLEKVLL------WV 384 + E++ +Q T + + ELEAR A+E ++ +++ + W+ Sbjct: 172 ELKEKRSLQEKSTNQGAEGTARVRELEARLEALEAQLQSMRAREEFQQQIHVCMARKAWL 231 Query: 385 ETQRAFLARPLPLADLQETLQKQTEYGNALKSCKQQAKNLADMAKEIE 528 E + FL L DL+ + E KQ+ + + KE+E Sbjct: 232 EYEELFLLYSATLKDLKLAKKCTEEKEQQYNQFKQEMEAILARKKELE 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.316 0.128 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,385 Number of Sequences: 2352 Number of extensions: 16044 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -