BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J23 (847 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 8.2 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 6.2 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 325 PVRDENDCDTRAYIKDDSVKIVTLMSAPIIPNSA-RDITRIVN 450 P+R +DC T + + D +V L +S R + IV+ Sbjct: 419 PIRKISDCSTTSSLSGDESDVVELQPVKSSKSSGWRKLRNIVH 461 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 381 QNSDAH-ERAHHSEQRQRHYEN 443 QN++ H ++AHHS + + N Sbjct: 441 QNNNQHNDQAHHSSKSNNRHNN 462 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,710 Number of Sequences: 438 Number of extensions: 4828 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -