BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J21 (859 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 1.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 1.0 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 24 1.8 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 3.1 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 4.1 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 5.4 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 7.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.1 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.6 bits (51), Expect = 1.0 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 568 VSPLTTARSLNWSSPSTPAPQVSTAVVEPY--NSILTTHK 681 +S LT+ + SPST S +V PY S LT H+ Sbjct: 690 LSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHE 729 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.6 bits (51), Expect = 1.0 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 568 VSPLTTARSLNWSSPSTPAPQVSTAVVEPY--NSILTTHK 681 +S LT+ + SPST S +V PY S LT H+ Sbjct: 582 LSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHE 621 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +1 Query: 589 RSLNWSSPSTPAPQVSTAVVEPYNSILTTHKTLXPLTVLSWST 717 R ++W T A + +T E N++ T T L+W T Sbjct: 109 REISWIFLETVANENTTNCPEQKNTVTVTFTVQSDDTTLNWGT 151 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -2 Query: 480 QRACGFCPKPNLRFPFQWCSDHGHSCW 400 Q C + PN C+D SCW Sbjct: 15 QLECNWSSGPNATLQSSACTDDLSSCW 41 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 405 NYARGHYTIGKEIVDLVLDRIRKLADQCTG 494 +YAR G IVD+ LD R L CTG Sbjct: 392 SYARAKGLGGIAIVDITLDDFRGL---CTG 418 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 684 GFVGGEDRVVGLDDGS 637 GF+ GE VV DDGS Sbjct: 214 GFIVGEYGVVSHDDGS 229 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 292 RGTCLPAPVSLKKVLKES 239 RGTC P LKK L ++ Sbjct: 53 RGTCSPDGEELKKALPDA 70 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.1 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = +1 Query: 580 TTARSLNWSSPSTPAPQVSTAVVEPYNSILTTHKTLXPLTVLSWSTMXPSMTSAA 744 TT S WSS +T +T + TT T T +W T ++ A Sbjct: 1036 TTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPA 1090 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,731 Number of Sequences: 336 Number of extensions: 4179 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -