BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J14 (854 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 24 1.8 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 24 1.8 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 24 1.8 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 7.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.4 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 127 MRAFVV--LACVAMAYGRPEPPVGYSY 201 MR FV+ +ACV++A RPE Y Sbjct: 1 MRFFVIFFVACVSVALARPEDQYTIKY 27 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -2 Query: 592 RSGRSWGLDEDDLVMFLGWSHSRDNEEVFAQLVLGEVREHR 470 RSG SW E + G +H+ D +F + R HR Sbjct: 424 RSGNSWFEHETESGRNFGAAHADDVPYIFNMGLFDTSRNHR 464 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -2 Query: 592 RSGRSWGLDEDDLVMFLGWSHSRDNEEVFAQLVLGEVREHR 470 RSG SW E + G +H+ D +F + R HR Sbjct: 424 RSGNSWFEHETESGRNFGAAHADDVPYIFNMGLFDTSRNHR 464 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 55 LIGY*INYHRVS 90 L+GY INY R+S Sbjct: 112 LLGYSINYRRIS 123 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 487 PPEPVEQRLPRYPCCGSTPETLQDHLH 567 PPEPV P+ T + +H+H Sbjct: 1006 PPEPVTPAPPQVTTGVDTGASSTEHMH 1032 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,751 Number of Sequences: 336 Number of extensions: 2179 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -