BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J14 (854 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457553-1|AAL68783.1| 178|Anopheles gambiae mucin-like protein... 29 0.24 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.9 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.9 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 25 2.9 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 5.1 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 5.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 6.8 >AF457553-1|AAL68783.1| 178|Anopheles gambiae mucin-like protein protein. Length = 178 Score = 28.7 bits (61), Expect = 0.24 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 6/75 (8%) Frame = -3 Query: 450 STRVSTRISATESSITSEAQTAAAAK------GESTTETESIRRVSAAKGNAASRKAT*G 289 ++ +T + T ++ TSEA T AAA ++TT T + A+ ++S +T Sbjct: 67 TSAATTTAATTSAATTSEATTTAAASTTQASDSDNTTTTAEATTTTEAQTTSSSDNSTTT 126 Query: 288 SRMTTNSNSSVSAAD 244 T + +S + AD Sbjct: 127 EAAATTTAASETTAD 141 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 510 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 403 S L+WF RY N + + + ST V I+ T +++T Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 510 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 403 S L+WF RY N + + + ST V I+ T +++T Sbjct: 614 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 647 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 510 SLLNWFWGRYVNIDVFLYKRSTRVSTRISATESSIT 403 S L+WF RY N + + + ST V I+ T +++T Sbjct: 592 SYLSWF--RYANEALLINQWSTVVDGEIACTRANVT 625 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 5.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 532 GSTPETLQDHLHQGPNSSHSYCPHNSYPTTK 624 G PETL+ H+ Q P + + C T+K Sbjct: 986 GVLPETLEAHMLQSPTNWSNVCEAAKRITSK 1016 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 532 GSTPETLQDHLHQGPNSSHSYC 597 G PETL +H+ Q P + + C Sbjct: 1046 GVVPETLLEHMLQSPENWSNVC 1067 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 6.8 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -3 Query: 396 AQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTTNSNSSVSAADRGRA 232 + T A STT S VS+A N+A + T+N+N+++ D G A Sbjct: 1866 SMTVPATSSVSTTGGSSSTMVSSAVSNSAVATGPAVNNGTSNNNNAL-GEDGGNA 1919 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,925 Number of Sequences: 2352 Number of extensions: 9878 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -