BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J08 (823 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0090 + 17228253-17228403,17229062-17229129,17229238-172309... 31 0.84 04_04_1540 - 34245246-34245797,34246904-34247157,34247989-34248577 28 7.8 >03_04_0090 + 17228253-17228403,17229062-17229129,17229238-17230902, 17231002-17231143,17231648-17232399 Length = 925 Score = 31.5 bits (68), Expect = 0.84 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -2 Query: 165 FTSGLRESSSLYSTTKHPESQHSSCSS*NLASFMRRYHTKLHYLQRTR--GKP 13 F+ + E+SSL + S SSCSS + R +L Y+ + R GKP Sbjct: 77 FSKSMTENSSLSMESSRASSSSSSCSSFSSTDINRPIQQELSYINKERFAGKP 129 >04_04_1540 - 34245246-34245797,34246904-34247157,34247989-34248577 Length = 464 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 304 VPLAIQHGKHKIYWNSKASSSRMVATS 224 +P A+ HG +YW+ A+ SR+ A+S Sbjct: 53 LPRALNHGLLDLYWSLPAADSRIPASS 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,323,294 Number of Sequences: 37544 Number of extensions: 412552 Number of successful extensions: 926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2256438528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -