BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J06 (864 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p... 27 2.6 SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces po... 27 2.6 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 27 3.4 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 27 4.5 SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pom... 26 7.9 SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 26 7.9 SPBC8E4.03 |||agmatinase 2 |Schizosaccharomyces pombe|chr 2|||Ma... 26 7.9 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 26 7.9 >SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 27.5 bits (58), Expect = 2.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 378 HSPSWPSEVWHERSSFVETPGTRVDGALSAT 286 HS ++P+E+W R E P + D L+ T Sbjct: 45 HSLTFPTEIWETRDGLFEEPVGKGDSHLNHT 75 >SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 27.5 bits (58), Expect = 2.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -3 Query: 643 GLSELGLAVHVARGPEGNAVRVPPAAALVHWQGLRP---GRDGI 521 G+S+L +HV R P NA +P V ++G+ P G DG+ Sbjct: 147 GMSDLKWELHVIRDPTPNAFVLPGGKVFV-FEGILPMCKGEDGL 189 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 357 PTAKKGSASTITCAMRPITPLSLTEQTSSI*ESAVARVHRTST 485 P + +T TC+ RP +S TS++ ES + TST Sbjct: 567 PEETTTTMTTTTCSSRPEETISTVSTTSTVSESGSSSASITST 609 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 26.6 bits (56), Expect = 4.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 498 LPTRDRQQIPSRPGRRP 548 LP+R +PSRPG RP Sbjct: 114 LPSRGTPSLPSRPGSRP 130 >SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 781 Score = 25.8 bits (54), Expect = 7.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +3 Query: 297 GLHRPWCL 320 GLHRPWCL Sbjct: 685 GLHRPWCL 692 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 409 IGRIAQVIVDALPFLAVGGLARKVIVRRDARHQGRWSPI 293 +GR+A+V++D L G A + + R +R G ++P+ Sbjct: 1313 LGRLARVVIDEAHLLLTSG-AWRTALSRASRLSGLYAPL 1350 >SPBC8E4.03 |||agmatinase 2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 413 Score = 25.8 bits (54), Expect = 7.9 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 Query: 439 DVCSVSDNGVIGRIAQVIVDALPFLAV 359 ++ + NG++ RI QV+ D L +L++ Sbjct: 304 EIDEIGVNGIVERIKQVVGDTLVYLSI 330 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 409 IGRIAQVIVDALPFLAVGGLARKVIVRRDARHQGRWSPI 293 +GR+A+V++D L G A + + R +R G ++P+ Sbjct: 1313 LGRLARVVIDEAHLLLTSG-AWRTALSRASRLSGLYAPL 1350 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,068,825 Number of Sequences: 5004 Number of extensions: 57922 Number of successful extensions: 178 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 430470850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -