BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J05 (842 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 27 2.5 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 26 7.7 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 27.5 bits (58), Expect = 2.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 301 EVGGSMKVKKHLQSTRGPAVV 363 +VGG +K +H Q T+ PA+V Sbjct: 712 QVGGDVKATEHTQPTKTPAIV 732 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 412 IVFYTHTIKNINKDKPYSILNL-TTDV-KNKSLTVNSMHAC 528 ++F+ K N D P+SILN +D+ N S N +H C Sbjct: 173 LLFFMINSKITNYDLPFSILNSPCSDLCLNSSSLANYLHGC 213 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,926,905 Number of Sequences: 5004 Number of extensions: 53907 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 416455520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -