BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J03 (849 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.0 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.3 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 5.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 63 AWNSL*NNTNL*IYKTQTWLPHIMLTSERRPMMSSXKGYHFGVFKL 200 +WN + TN ++ W P I TSE+ P+ K G FK+ Sbjct: 1357 SWNPG-STTNYPEWQPTEWHPPIPPTSEKPPLPEELKP-QSGYFKI 1400 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 111 VFYKFTNWYYFTENSTQIGARDQSLHCPPQDNF 13 VF+K Y E ++ R P QDNF Sbjct: 161 VFHKLKKMKYLVEVQDEVKPRGVLNIIPKQDNF 193 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 416 PXKGDFKASSNLVLDCD 366 P GD+ S N +DCD Sbjct: 634 PQCGDYVPSGNSTVDCD 650 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 9.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 572 TPASQPW*FSTAATSTTGPAKSRSKLVFTATVSL 471 +P+S P T TST+ P S S+ V T+ S+ Sbjct: 76 SPSSTPSSLPTQRTSTSNPTYS-SRSVMTSCSSV 108 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 9.3 Identities = 6/23 (26%), Positives = 12/23 (52%) Frame = -3 Query: 418 CLXRVTLRPAAILSWIVMSVANV 350 C +++RP + L W S+ + Sbjct: 556 CYYSISIRPISTLGWFFWSLLRI 578 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,378 Number of Sequences: 336 Number of extensions: 4269 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -