BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J03 (849 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01280.1 68416.m00035 porin, putative similar to SP|P42055 34... 34 0.10 At3g13610.1 68416.m01713 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 3.9 At3g17365.1 68416.m02219 expressed protein low similarity to PIR... 28 6.8 At4g30810.1 68417.m04365 serine carboxypeptidase S10 family prot... 28 9.0 At1g50040.1 68414.m05615 expressed protein 28 9.0 >At3g01280.1 68416.m00035 porin, putative similar to SP|P42055 34 kDa outer mitochondrial membrane protein porin (Voltage-dependent anion-selective channel protein) (VDAC) {Solanum tuberosum}; contains Pfam profile PF01459: Eukaryotic porin Length = 276 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/79 (21%), Positives = 37/79 (46%) Frame = +1 Query: 445 TGELKTSFTNDTVAVNTNLDLDLAGPVVDVAAVLNYQGWLAGVHTQFDTQKAKFSKNNFA 624 +G+++ + ++ ++T++ L P V+ + V+ G FDT+ F+K N Sbjct: 103 SGKVELQYLHEYAGISTSMGLT-QNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAG 161 Query: 625 LGYQSGDFALHTSVDNGKD 681 L + D +V++ D Sbjct: 162 LSFTKEDLIASLTVNDKGD 180 >At3g13610.1 68416.m01713 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to desacetoxyvindoline 4-hydroxylase [Catharanthus roseus][GI:1916643], flavonol synthase 1 [SP|Q96330]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 361 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -3 Query: 394 PAAILSWIVMSVANVLSVFHFSVKVKP*SFTANLEERLPKTFPLSWLEVIPLVN-STPD 221 PA + ++V V + +K P + LEERL F E IP+++ S PD Sbjct: 13 PAEVTDFVVYKGNGVKGLSETGIKALPEQYIQPLEERLINKFVNETDEAIPVIDMSNPD 71 >At3g17365.1 68416.m02219 expressed protein low similarity to PIR|I46078 endothelin converting enzyme from Bos primigenius taurus Length = 239 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/68 (23%), Positives = 28/68 (41%) Frame = -3 Query: 721 SSLSDTFW*IXPPNLYHCLRLCGEQSHQIGNLEQSCSWRTLLFVYQTGCVHQPANPGSLV 542 + + + W + + L G +++ ++SCSW T L V QP + Sbjct: 137 TQMLEEVWRVLKDKGVYILITYGAPIYRLRLFKESCSWTTKLHVIDKSLTDQPLDTPKWE 196 Query: 541 LLQRLQLD 518 L + L LD Sbjct: 197 LTKPLPLD 204 >At4g30810.1 68417.m04365 serine carboxypeptidase S10 family protein similar to serine-type carboxypeptidase (SP:P55748) [Hordeum vulgare] Length = 479 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 323 SQAIVFHCKFGGKAAKNLSAFLVGGDSAGEFNTRLAL 213 S+AIV H + K + NL ++VG +F+ RL L Sbjct: 196 SEAIVKHNQGSDKNSINLKGYMVGNGLMDDFHDRLGL 232 >At1g50040.1 68414.m05615 expressed protein Length = 460 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 114 TWLPHIMLTSERRPMMSSXKGYHFGVFK 197 TW P + L + R P +S GY F ++K Sbjct: 290 TWKPWVRLQAWREPGVSDVLGYRFELYK 317 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,992,214 Number of Sequences: 28952 Number of extensions: 369814 Number of successful extensions: 936 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -