BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_J02 (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 3.5 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 22 8.1 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 411 SSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 295 ++ +S A AAAA +T +S R ++ GN A A Sbjct: 125 TAASSAALAAAAAVDAATAGDKSCRYTASLAGNVAPASA 163 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.8 bits (44), Expect = 8.1 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = -2 Query: 677 IRLLFRLXNQHIYECLLFVLWLDRNYGGSRSGRSWGLDEDDLVM 546 I FR+ ++ +L + +DR Y + + W +D+ +M Sbjct: 113 IMAFFRMFGLYLSSFVLVCISMDRYYAVIKPLQLWDVDKRGKIM 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,132 Number of Sequences: 438 Number of extensions: 3384 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -