BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I19 (850 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 44 4e-05 SPAC2C4.15c |ubx2|ucp13|UBX domain protein Ubx2|Schizosaccharomy... 33 0.068 SPBC19G7.06 |mbx1||MADS-box transcription factor Mbx1|Schizosacc... 27 4.4 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 43.6 bits (98), Expect = 4e-05 Identities = 19/57 (33%), Positives = 33/57 (57%) Frame = +1 Query: 163 NREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENGGNADEAPANPTSAAS 333 +RED L++FC+ D + +FFLES+NW ++A + +E ++ P+S S Sbjct: 2 DREDILKEFCNRNNIDVSQGRFFLESTNWNYELATALLHEVIPPEEDHGLQPSSDVS 58 >SPAC2C4.15c |ubx2|ucp13|UBX domain protein Ubx2|Schizosaccharomyces pombe|chr 1|||Manual Length = 427 Score = 32.7 bits (71), Expect = 0.068 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +1 Query: 154 MSANREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENGGNAD 300 M + + FC +T + ++++ +L ++ L A++ F+E+GG D Sbjct: 1 MDGDEASLVANFCAITNSTPEKAQEYLSVADGDLSTAITLFFESGGVTD 49 >SPBC19G7.06 |mbx1||MADS-box transcription factor Mbx1|Schizosaccharomyces pombe|chr 2|||Manual Length = 436 Score = 26.6 bits (56), Expect = 4.4 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 289 GNADEAPANPTSAASFSVLPDS 354 G+ ++P P+S++SFSV P+S Sbjct: 175 GDYSDSPLEPSSSSSFSVPPES 196 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,687,084 Number of Sequences: 5004 Number of extensions: 48176 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -