BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I19 (850 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0850 - 25354002-25354391,25354480-25354575,25355352-253556... 47 2e-05 10_08_0654 - 19616426-19616656,19617046-19617249,19617654-196178... 36 0.031 04_04_1541 + 34249778-34249882,34249964-34250115,34250225-342503... 33 0.38 06_01_0903 - 6939672-6939782,6940051-6940110,6940221-6940322,694... 32 0.66 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 30 2.0 08_02_1480 + 27401923-27402158,27402847-27402982,27403119-274031... 28 8.2 08_02_1473 - 27358162-27358275,27358968-27359024,27359102-273592... 28 8.2 >06_03_0850 - 25354002-25354391,25354480-25354575,25355352-25355634, 25357213-25357799 Length = 451 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 157 SANREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENG-GNADEAPAN 315 +A + + FC VT A + FFLES NW L+ A+ SFY++ G+A A A+ Sbjct: 12 AAEAQSLVESFCGVTSATPQEAAFFLESHNWALESAVRSFYDSADGDASAAAAD 65 >10_08_0654 - 19616426-19616656,19617046-19617249,19617654-19617824, 19619617-19620411 Length = 466 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 154 MSANREDTLRQFCDVTG-ADEDRSKFFLESSNWQLDVALSSFYENGGNADEAPANP 318 M+ +D + F VTG +D D L + NW L +A+SS N + D AP+ P Sbjct: 1 MAETVDDKVSYFQAVTGISDHDLCTEILAAHNWDLQLAVSSITANPSSPDPAPSAP 56 >04_04_1541 + 34249778-34249882,34249964-34250115,34250225-34250350, 34251868-34252030,34252601-34252678,34252749-34252847, 34253045-34253188,34253344-34253446,34255303-34255646, 34255727-34255891 Length = 492 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 160 ANREDTLRQFCDVT-GADEDRSKFFLESSNWQLDVALSSFYENGGNADEAPANPTSAAS 333 A +E + F ++ G + + FL+ ++W L+ AL FY +G A A P+ AA+ Sbjct: 9 AEKESLVTSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSPAAA 67 >06_01_0903 - 6939672-6939782,6940051-6940110,6940221-6940322, 6940464-6940513,6940686-6940750,6940849-6940931, 6941117-6941140,6941798-6941856,6942041-6942174, 6942823-6942884,6942908-6942976 Length = 272 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 172 DTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFY 279 D ++QF +TGA E + L++S+W L+ A FY Sbjct: 32 DKVQQFMTITGASEKVALQALKASDWHLEGAFDFFY 67 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 125 LIQNIYSKLPCLRIEKIHYVSFVMLP 202 LI NI KLPCLR+ + Y LP Sbjct: 404 LIDNILPKLPCLRVLDLSYTQLESLP 429 >08_02_1480 + 27401923-27402158,27402847-27402982,27403119-27403168, 27403810-27403813,27404394-27404494,27405084-27406305 Length = 582 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +3 Query: 384 GTKVPEKRKKEN--LKYKVWDHRIAAAGKLKR*GRR 485 GTK P R+K L + W+H ++ GKL+ GR+ Sbjct: 81 GTKSPWSRRKRKRPLSCRHWNHLFSSDGKLRDGGRK 116 >08_02_1473 - 27358162-27358275,27358968-27359024,27359102-27359245, 27359770-27359934,27360020-27360208,27360301-27360535, 27360826-27360932,27361020-27361103,27361185-27361695, 27361793-27361854,27363373-27363456 Length = 583 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 169 EDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENGG-NADEAPANP 318 +D + F +TGADE + LE + L+ A+++++ G + A NP Sbjct: 6 QDAIDTFVGITGADEAVAARKLEEHHGDLNEAVNAYFNEGDRTSTRANENP 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,401,596 Number of Sequences: 37544 Number of extensions: 307389 Number of successful extensions: 721 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -