Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_FL5_I17
         (882 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    24   1.6  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    24   1.6  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    24   1.6  
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    23   3.7  

>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +1

Query: 793 FKIHSPKAHS 822
           FK+H PKAHS
Sbjct: 353 FKVHDPKAHS 362


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +1

Query: 793 FKIHSPKAHS 822
           FK+H PKAHS
Sbjct: 353 FKVHDPKAHS 362


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +1

Query: 793 FKIHSPKAHS 822
           FK+H PKAHS
Sbjct: 291 FKVHDPKAHS 300


>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 13/36 (36%), Positives = 16/36 (44%)
 Frame = -1

Query: 546 DGQCLAYNTTHYRDHFVQESWVRVSLGPSRDTXERP 439
           D Q   Y    + +  V  + VRV LGP  D   RP
Sbjct: 514 DHQPYQYKIAVHSEQNVPGAVVRVFLGPKHDHQGRP 549


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 236,354
Number of Sequences: 438
Number of extensions: 4843
Number of successful extensions: 15
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)