BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I17 (882 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 24 1.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 24 1.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 24 1.6 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.7 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 793 FKIHSPKAHS 822 FK+H PKAHS Sbjct: 353 FKVHDPKAHS 362 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 793 FKIHSPKAHS 822 FK+H PKAHS Sbjct: 353 FKVHDPKAHS 362 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 793 FKIHSPKAHS 822 FK+H PKAHS Sbjct: 291 FKVHDPKAHS 300 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 3.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -1 Query: 546 DGQCLAYNTTHYRDHFVQESWVRVSLGPSRDTXERP 439 D Q Y + + V + VRV LGP D RP Sbjct: 514 DHQPYQYKIAVHSEQNVPGAVVRVFLGPKHDHQGRP 549 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,354 Number of Sequences: 438 Number of extensions: 4843 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -