BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I14 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 6.5 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 6.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 6.5 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 319 CKPAPDDSVLTQALLKRHTELCPSPTD 399 CK APD + +T+ L+ P+PTD Sbjct: 611 CK-APDQAAVTRPLMAADLGAGPAPTD 636 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +1 Query: 295 LAEPAFPRCKPAPDDSVLTQALLKRHTELCPSPTDQAAVLSLVTKLQTVL 444 +AEP PAP+ +L + + + C A +L +T + +L Sbjct: 103 IAEPKAASATPAPELELLRATIQRLEEQNCAMKEQNAKLLEQITGMCQLL 152 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 195 RSWWTRYPRPGRDGASTLQQTP 260 R+W RY + G TL++TP Sbjct: 1876 RTWGMRYEYDNQSGLLTLKRTP 1897 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 195 RSWWTRYPRPGRDGASTLQQTP 260 R+W RY + G TL++TP Sbjct: 1877 RTWGMRYEYDNQSGLLTLKRTP 1898 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,484 Number of Sequences: 2352 Number of extensions: 14435 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -