BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I09 (830 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 4.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 4.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 4.6 X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. 22 6.0 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 8.0 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 519 FTDCFRCFFRFYWI 478 F CF CF YWI Sbjct: 412 FPVCFVCFNLMYWI 425 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 519 FTDCFRCFFRFYWI 478 F CF CF YWI Sbjct: 412 FPVCFVCFNLMYWI 425 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 519 FTDCFRCFFRFYWI 478 F CF CF YWI Sbjct: 350 FPVCFVCFNLMYWI 363 >X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. Length = 70 Score = 22.2 bits (45), Expect = 6.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 472 YGDPVEPEKAPEAISKAVATLPPE 543 Y P EPE APE ++A A PE Sbjct: 20 YAAP-EPEPAPEPEAEADAEADPE 42 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 8.0 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 597 IRIILNTKFHLLHQFKHLFWRQCRHSFTDCFRCFFRFYWIT 475 + +IL FH L +FW R + FR + W+T Sbjct: 317 VTVILGLLFHALITLPTIFWFLTRQNPAAFFRGMMQ-AWMT 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,995 Number of Sequences: 438 Number of extensions: 4835 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -