BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I06 (858 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 120 2e-27 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 1.6 SB_57110| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-22) 29 3.7 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 29 3.7 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 29 4.8 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 6.4 SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) 28 8.5 SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) 28 8.5 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 120 bits (289), Expect = 2e-27 Identities = 68/150 (45%), Positives = 93/150 (62%) Frame = +2 Query: 26 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 205 MAAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFET 59 Query: 206 ADGKVLLTESNAIAYYVANESLRGGDLATQARVWQWASWSDSELLPASCAWVFPYLGIMQ 385 AN R L T + +++D ELLPA+ WVFP G+MQ Sbjct: 60 K---------------TANACTRAMPLLTT-----YVNFADQELLPAAATWVFPTYGMMQ 99 Query: 386 FNKQNVERAKSDLLAALKVLDGHLLTRTFL 475 ++KQ+ ++A D+ + +L+ LL +TFL Sbjct: 100 YHKQSTDKAMEDVKKYMTMLNDVLLMKTFL 129 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +2 Query: 59 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 238 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 239 AIAYYVANESL 271 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_57110| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-22) Length = 559 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -3 Query: 142 LAKYEIRCYFHISPGILCGDQRFISAEVFRISVKYPGRHGWSFRKE 5 L K +R +I L + FI+ V +S+ G+H WSF KE Sbjct: 200 LRKDSLRTVSNILVAALALSELFITVVVIPLSIIAYGKHLWSFHKE 245 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 29.5 bits (63), Expect = 3.7 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 4/104 (3%) Frame = +2 Query: 176 PAGKVPAFESADGKVLLTESNAIAYYVA--NESLRGGDLATQARVWQWASWSDSELLPAS 349 P +P E+ +G SN I Y+A ++ L G DL + +V QW + + A Sbjct: 45 PFNTLPLLETKEGTFF--SSNTIIRYLAASSDKLYGSDLFQRGQVDQWLDITTCDFEAAV 102 Query: 350 CAWVFPYLGIMQFNKQNVERAK--SDLLAALKVLDGHLLTRTFL 475 A G ++VE AK +D+ L ++ HL R FL Sbjct: 103 AAVAIAKEG------RDVEGAKIVADINKFLGFVEKHLAGRKFL 140 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 281 DLATQARVWQWASWSDSELLPASCA 355 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 281 DLATQARVWQWASWSDSELLPASCA 355 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 188 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 69 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) Length = 1898 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 656 SSYIRP*KVPGVSWCTEQEGGQKRXXCEKKEHPRKG 763 S I P +V GV WC E + Q R + K R+G Sbjct: 227 SETIPPERVLGVQWCIESDSLQFRITLQDKPIKRRG 262 >SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) Length = 245 Score = 28.3 bits (60), Expect = 8.5 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = -3 Query: 586 R*TFISDERTLGSSTCWKACSSVLKTMTSASVILSVTKEGACEKMSVQY 440 R T+ SD RT S+T C + T TS S S T G C +S Y Sbjct: 23 RCTYTSD-RTTTSTTTIGVCPIIRCTYTSDSSTTSATTIGVCSIISCTY 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,274,661 Number of Sequences: 59808 Number of extensions: 605623 Number of successful extensions: 1555 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1552 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -