BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I06 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 35 0.004 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.42 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 27 0.55 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 27 0.55 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 27 0.97 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 26 1.7 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 25 3.9 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 5.1 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 24 5.1 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 24 5.1 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 9.0 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 9.0 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 9.0 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 34.7 bits (76), Expect = 0.004 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 7/105 (6%) Frame = +2 Query: 80 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 259 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 Query: 260 -------NESLRGGDLATQARVWQWASWSDSELLPASCAWVFPYL 373 +++L D+A +A+V Q + L+ + + P L Sbjct: 79 ERYGAADDDTLYPKDIALRAKVNQRLFYDIGTLMRSVTTYYHPIL 123 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 143 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 256 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 27.5 bits (58), Expect = 0.55 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 522 LLHAFQHVLDPSVRSSLINVQRWFLTVAHQPQVSAVVGSL 641 L+ Q L PS+ S+L ++ RW + A P V G+L Sbjct: 61 LVQNIQFGLSPSLTSALESIPRWRIVQAALPHVIHCAGAL 100 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 27.5 bits (58), Expect = 0.55 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 282 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCNSTNRMLNVQ 413 + LPKP G C+L ALG L + N NR + Q Sbjct: 550 VLLPKPGKPPGESSSYRPLCMLDALGKVLERLILNRLNRHIEQQ 593 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.6 bits (56), Expect = 0.97 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 292 GSQISSAETFIGNVVSDGIAFS*KHLSIGTFEC 194 GSQ +AE F G + +GI + K + EC Sbjct: 88 GSQTGTAEEFAGRLAKEGIRYQMKGMVADPEEC 120 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 282 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCNSTNRML 404 + LPKP G +G C+L ALG L + N + L Sbjct: 542 VLLPKPGKPPGSNGSYRPLCMLDALGKVLEKLILNRLHNHL 582 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.6 bits (51), Expect = 3.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 657 PPTYDPKKYQELAGA 701 PP Y P++YQ +AG+ Sbjct: 33 PPEYLPERYQRIAGS 47 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 5.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -1 Query: 618 LAAGGRRSGTNAERLSATNGRSGLARAGKHAAVY 517 LAAGG G+ S T G G+A G Y Sbjct: 514 LAAGGGGGGSGCVNGSRTVGAGGMAGGGSDGPEY 547 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 197 FESADGKVLLTESNAIAYYVANESLRGGDLATQARVW 307 F+S V +T SN ++ L GG + T R W Sbjct: 39 FQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 197 FESADGKVLLTESNAIAYYVANESLRGGDLATQARVW 307 F+S V +T SN ++ L GG + T R W Sbjct: 39 FQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 654 PHRA*ASRRRPTLAAGGRRSGTNAERL 574 P R + PT+A GG +G AE + Sbjct: 250 PRRQMTGKPGPTIATGGASTGDAAEEI 276 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 9.0 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 219 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 73 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 282 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCN 386 + LPKP G C+L ALG L + N Sbjct: 497 VLLPKPGKAPGESSSYRPLCMLDALGKVLERLILN 531 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 899,216 Number of Sequences: 2352 Number of extensions: 19243 Number of successful extensions: 48 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -