BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I02 (812 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0238 - 1988688-1988830,1988989-1989257,1989339-1989600,198... 28 7.7 >08_01_0238 - 1988688-1988830,1988989-1989257,1989339-1989600, 1989693-1989805,1990560-1990594,1990771-1990878, 1992178-1992483 Length = 411 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 151 CTYIVASKNVNFPSX*KEERCHVIMYLITCY 243 CT++++SK +NFP H++ + C+ Sbjct: 101 CTWVLSSKEINFPYPVALTLLHMVFSSVVCF 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,816,883 Number of Sequences: 37544 Number of extensions: 313714 Number of successful extensions: 526 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2221181676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -