BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I02 (812 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128694-1|BAC87575.1| 291|Homo sapiens protein ( Homo sapiens ... 33 0.93 >AK128694-1|BAC87575.1| 291|Homo sapiens protein ( Homo sapiens cDNA FLJ46861 fis, clone UTERU3011092. ). Length = 291 Score = 33.5 bits (73), Expect = 0.93 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -3 Query: 294 HLFSYLCIYCILSEARCVTSYQVHDYMTSFFFLXRRK-VHIFGCYYVCTH 148 H+ +Y+CI+ CV +H Y+ S+ + VH++ C ++C H Sbjct: 130 HMHTYMCIHMYTCIHICVFMCTMHAYVYSYVHMHAYVCVHMYTCVHMCIH 179 Score = 30.7 bits (66), Expect = 6.5 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = -3 Query: 336 INLEFLLSLSVYQY-HLFSYLCIYCILSEARCVTSYQVHDYMTSFFFLXRRKVHIFGCYY 160 I++ + + VY Y H+++Y+ I+ + CV SY +H Y T + VHI+ + Sbjct: 210 IHIYICIHVCVYSYIHMYTYVYIHVYIGIHMCVYSY-MHRY-TYVYIHICICVHIYTHIH 267 Query: 159 VCTH 148 + TH Sbjct: 268 IHTH 271 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,915,462 Number of Sequences: 237096 Number of extensions: 1898824 Number of successful extensions: 3145 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3144 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10092110758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -