BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_I02 (812 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical pr... 29 3.0 >Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical protein T06G6.2 protein. Length = 339 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 7/59 (11%) Frame = -3 Query: 312 LSVYQYHLFSYLCIYCILSEA-----RCVTS--YQVHDYMTSFFFLXRRKVHIFGCYYV 157 + ++ Y+L +Y Y + S A C T Y H Y S F L + + G YYV Sbjct: 111 VELFVYYLTTYFSTYSVFSLAFDRLISCYTPKYYLSHQYYVSIFLLFIQLIFTLGTYYV 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,518,249 Number of Sequences: 27780 Number of extensions: 320462 Number of successful extensions: 758 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1998381620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -