BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H24 (871 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 8.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 8.5 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 8.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 158 NVILFVGDGMGPNTVTATRIYKGGESHRLVYEKF 259 N+++ G +T T IYK G + EKF Sbjct: 9 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF 42 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 8.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 158 NVILFVGDGMGPNTVTATRIYKGGESHRLVYEKF 259 N+++ G +T T IYK G + EKF Sbjct: 9 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,221 Number of Sequences: 438 Number of extensions: 5233 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -