BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H20 (836 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_27033| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) 29 4.7 SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) 29 4.7 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 29 4.7 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 29 4.7 SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_21865| Best HMM Match : DUF1010 (HMM E-Value=1.5) 29 6.2 SB_37802| Best HMM Match : RnaseH (HMM E-Value=0.69) 29 6.2 SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/77 (25%), Positives = 35/77 (45%) Frame = +1 Query: 403 SEVMLDSVADMRVDTLVLLLYRNTSMFTYLPQNQLSKDFLVIPGCGSTPETLQDHLHQGP 582 + M+D++ + RV+ + LLL SM +L +L + + C +TP+ H P Sbjct: 427 NSAMMDALLNNRVEFVKLLLENGVSMGQFLTPERLLALYRGVRTCNATPDNNNRACHTTP 486 Query: 583 NSSHSYCPHNSYPTTKR 633 ++ C H KR Sbjct: 487 GNNKREC-HAKPDNNKR 502 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%) Frame = +3 Query: 24 LSHRNISKVGVVLIGY*INYHRV--SSKRISL----VSSKHKMRAFVVLACVAMAYGRPE 185 +SH + + + +IGY +YHRV S I L +SS H++ F+ L G P Sbjct: 637 VSHFLLLGIPLRIIGYPTSYHRVVFLSSGIPLPIIGLSSYHRVSHFLSLGIPLPIIGIPL 696 Query: 186 PPVGYSYSAPR 218 P +GY S R Sbjct: 697 PIIGYPTSYHR 707 >SB_27033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = -1 Query: 482 NIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESI---RRVSAAKGNAAS 312 N D+F +++ + + R S T+S+I + +A TT++++I + A++G Sbjct: 493 NKDIFRKQKTVQNTFRTSKTKSNIAELSMAVKSAARAKTTQSQNITKNKEEKASEGKGER 552 Query: 311 RKAT*GSRMTTNSNSSVS 258 +K T T+S +S S Sbjct: 553 KKNTSRPSSVTSSLTSSS 570 >SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) Length = 417 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +1 Query: 493 PQNQLSKDFLVIPGCGSTPETLQDHLHQGPNSSHSYCPHNSYPTTKRREDTRICAG 660 P+++L + +PG G P Q H+GP + TK D + G Sbjct: 309 PRSELRRQRFALPGLGCYPWRKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITG 364 >SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) Length = 1259 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +1 Query: 493 PQNQLSKDFLVIPGCGSTPETLQDHLHQGPNSSHSYCPHNSYPTTKRREDTRICAG 660 P++ L + +PG G P + Q H+GP + TK D + G Sbjct: 999 PRSALRRQRFALPGLGCYPWSKQTFRHEGPTHIRTMSTTQQSKITKTINDAAVITG 1054 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 4/95 (4%) Frame = -1 Query: 506 NWFWGRYVNIDVFLYKRSTRVSTRISATESSITSEAQTAAA----AKGESTTETESIRRV 339 N +Y N+D YKR T + +S+ SE+Q + + E T + +V Sbjct: 1263 NQLMEQYRNVDPDEYKRMTEEKKQFQQHVASLKSESQRSKTLLENVRNELTKTKAELTKV 1322 Query: 338 SAAKGNAASRKAT*GSRMTTNSNSSVSAADRGRAE 234 A N + + S+M + S S + +AE Sbjct: 1323 QAELLNVKNDQQKAQSQMEAIKSQSTSVEGKNQAE 1357 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +1 Query: 493 PQNQLSKDFLVIPGCGSTPETLQDHLHQGPNSSHSYCPHNSYPTTKRREDTRICAG 660 P+++L + +PG G P Q H+GP + TK D + G Sbjct: 1612 PRSELRRQRFALPGLGCYPWRKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITG 1667 >SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +1 Query: 493 PQNQLSKDFLVIPGCGSTPETLQDHLHQGPNSSHSYCPHNSYPTTKRREDTRICAG 660 P++ L + +PG G P + Q H+GP + TK D + G Sbjct: 1612 PRSALRRQRFALPGLGCYPWSKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITG 1667 >SB_21865| Best HMM Match : DUF1010 (HMM E-Value=1.5) Length = 359 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 409 VMLDSVADMRVDTLVLLLYRNTSMFTYLPQNQLSKDFLVIPGCGSTP 549 +++ SVA RV + LYR Y + FL + C STP Sbjct: 123 IVISSVAISRVSLYRVSLYRKYRYVEYRYIESIVTSFLALSSCSSTP 169 >SB_37802| Best HMM Match : RnaseH (HMM E-Value=0.69) Length = 756 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 550 ETLQDHLHQGPNSSHSYCPHNSYPTTKRREDTRICAG 660 +TL + H+ NS+H+Y + PT R T I G Sbjct: 563 QTLIEKQHEQRNSNHAYSEKSKAPTADFRPSTAITVG 599 >SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +1 Query: 400 ASEVMLDSVADMRVDTLVLLLYRNTSMFTYLPQNQLSKDFLV 525 A +V + D++V L LL NTSMF+ QN +SK ++ Sbjct: 266 ARKVFTNKTQDIKVSKLTRLLVANTSMFS---QNLVSKSAVI 304 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,439,423 Number of Sequences: 59808 Number of extensions: 344163 Number of successful extensions: 1210 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -