BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H15 (853 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 1.5 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 23 2.7 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 23 2.7 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 23 2.7 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 4.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.7 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 100 TSENILYSSYESQLKRENQ 156 +SEN+ Y + ES +K ENQ Sbjct: 270 SSENLYYVNTESLMKSENQ 288 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 23.4 bits (48), Expect = 2.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 580 DLLLEVRRRVGWFSWWT 530 D +LEV ++ WF WT Sbjct: 126 DNMLEVSSKMPWFKGWT 142 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 23.4 bits (48), Expect = 2.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 580 DLLLEVRRRVGWFSWWT 530 D +LEV ++ WF WT Sbjct: 142 DNMLEVSSKMPWFKGWT 158 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 580 DLLLEVRRRVGWFSWWT 530 D +LEV ++ WF WT Sbjct: 199 DNMLEVSSKMPWFKGWT 215 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 4.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 533 PPTEPSDSAPDFQKQINAWFDEVGKYGSKPITG 631 PP PS S PD K ++ FD K + ++G Sbjct: 344 PPPPPSSSGPDSAK-LDKIFDIATKENAMLLSG 375 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.7 Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 8/68 (11%) Frame = +1 Query: 322 HNRLRQT-VALGQITKQPPAANMMEMIWDDELAATAQRWSDQCIPA-------HDRAAQR 477 ++ +R T ++ G ++ N M+ IW+D++ T RW + +P+ +D + Sbjct: 33 NDNIRNTLISNGDYIEENNMPNGMQ-IWNDKVFITIPRWKNG-VPSNLNFFLKNDESESP 90 Query: 478 DLGRFPXW 501 L +P W Sbjct: 91 KLNPYPNW 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,887 Number of Sequences: 438 Number of extensions: 5225 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -