BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H15 (853 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09590.1 68416.m01139 pathogenesis-related protein, putative ... 41 0.001 At2g19980.1 68415.m02336 allergen V5/Tpx-1-related family protei... 40 0.002 At4g25780.1 68417.m03710 pathogenesis-related protein, putative ... 37 0.020 At1g01310.1 68414.m00047 allergen V5/Tpx-1-related family protei... 37 0.020 At1g50060.1 68414.m05617 pathogenesis-related protein, putative ... 36 0.045 At5g02730.1 68418.m00214 allergen V5/Tpx-1-related family protei... 34 0.10 At2g19990.1 68415.m02337 pathogenesis-related protein 1 (PR-1) i... 34 0.10 At2g14610.1 68415.m01643 pathogenesis-related protein 1 (PR-1) i... 34 0.14 At2g14580.1 68415.m01633 pathogenesis-related protein, putative ... 34 0.14 At5g57625.1 68418.m07199 allergen V5/Tpx-1-related family protei... 33 0.24 At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei... 33 0.24 At5g26130.1 68418.m03108 pathogenesis-related protein, putative ... 33 0.32 At4g33710.1 68417.m04787 pathogenesis-related protein, putative ... 32 0.56 At4g31470.1 68417.m04471 pathogenesis-related protein, putative ... 32 0.56 At4g30320.1 68417.m04310 allergen V5/Tpx-1-related family protei... 32 0.56 At4g33730.1 68417.m04789 pathogenesis-related protein, putative ... 31 1.3 At2g19970.1 68415.m02335 pathogenesis-related protein, putative ... 30 1.7 At4g33720.1 68417.m04788 pathogenesis-related protein, putative ... 30 2.2 At1g50050.1 68414.m05616 pathogenesis-related protein, putative ... 30 2.2 At5g01450.1 68418.m00058 expressed protein 29 5.2 At5g66590.1 68418.m08394 allergen V5/Tpx-1-related family protei... 28 9.1 >At3g09590.1 68416.m01139 pathogenesis-related protein, putative similar to SP|Q05968 Pathogenesis-related protein 1 precursor {Hordeum vulgare}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 186 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 569 QKQINAWFDEVGKYGSKPITGGHGT--GHYSQLVWGETSHVGC 691 +K + WF+E Y K T G GHY+Q+VW ET+ VGC Sbjct: 115 EKVVTRWFEERFNYDVKTNTCAPGKMCGHYTQMVWRETTAVGC 157 >At2g19980.1 68415.m02336 allergen V5/Tpx-1-related family protein low similarity to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 165 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/69 (31%), Positives = 30/69 (43%) Frame = +2 Query: 488 DSLXGQNLAATWATRPPTEPSDSAPDFQKQINAWFDEVGKYGSKPITGGHGTGHYSQLVW 667 D G+N+AA W T A F WF E Y GHY+Q+V Sbjct: 74 DGTYGENIAAGWVQPMDTMSGPIATKF------WFTEKPYYNYATNKCSEPCGHYTQIVA 127 Query: 668 GETSHVGCG 694 +++H+GCG Sbjct: 128 NQSTHLGCG 136 >At4g25780.1 68417.m03710 pathogenesis-related protein, putative similar to gene PR-1 protein - Medicago truncatula, SP|Q40374; contains Pfam profile PF00188: SCP-like extracellular protein Length = 190 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 608 YGSKPITGGHGTGHYSQLVWGETSHVGC 691 YGS G GHY+Q+VW T VGC Sbjct: 135 YGSNTCDAGQMCGHYTQIVWKSTRRVGC 162 >At1g01310.1 68414.m00047 allergen V5/Tpx-1-related family protein similar to pathogenesis related protein-1 GB:AAC25629 GI:3290004 from [Zea mays]; contains Pfam profile PF00188: SCP-like extracellular protein Length = 241 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYGSKPIT--GGHGTGHYSQLVWGETSHVGC 691 +N W DE Y K T H GHY+Q+VW +++ VGC Sbjct: 152 VNVWADEDKFYDVKGNTCEPQHMCGHYTQIVWRDSTKVGC 191 >At1g50060.1 68414.m05617 pathogenesis-related protein, putative similar to prb-1b [Nicotiana tabacum] GI:19970; contains Pfam profile PF00188: SCP-like extracellular protein Length = 161 Score = 35.5 bits (78), Expect = 0.045 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 2/95 (2%) Frame = +2 Query: 413 WQLLLNAGPINVYPLTTALPNVIWADSLXGQNLAATWATRPPTEPSDSAPDFQKQINAWF 592 W L A +N A N++ ++ G+NLA + S S+ + W Sbjct: 48 WDTTLAAYALNYSNFRKADCNLVHSNGPYGENLA---------KGSSSSFSAISAVKLWV 98 Query: 593 DEVG--KYGSKPITGGHGTGHYSQLVWGETSHVGC 691 DE Y TGG HY+Q+VW ++ +GC Sbjct: 99 DEKPYYSYAYNNCTGGKQCLHYTQVVWRDSVKIGC 133 >At5g02730.1 68418.m00214 allergen V5/Tpx-1-related family protein low similarity to SP|Q05968 Pathogenesis-related protein 1 precursor {Hordeum vulgare}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 205 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 569 QKQINAWFDEVGKYGSKPITGGHGT--GHYSQLVWGETSHVGC 691 ++ ++ W DE Y T G GHY+Q+VW T+ VGC Sbjct: 122 RRVVDKWMDESLNYDRVANTCKSGAMCGHYTQIVWRTTTAVGC 164 >At2g19990.1 68415.m02337 pathogenesis-related protein 1 (PR-1) identical to pathogenesis-related protein 1 {Arabidopsis thaliana} GI:166805; contains an extracellular proteins SCP/Tpx-1/Ag5/PR-1/Sc7 signature (PDOC00772) Length = 176 Score = 34.3 bits (75), Expect = 0.10 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 500 GQNLAATWATRPPTEPSDSAPDFQKQINAWFDEVGKYGSKPIT-GGHGT-GHYSQLVWGE 673 G+NLAA W T S P + W E Y T GG G GHY+Q+VW + Sbjct: 92 GENLAAGWGTM-------SGPVATEY---WMTEKENYDYDSNTCGGDGVCGHYTQIVWRD 141 Query: 674 TSHVGC 691 + +GC Sbjct: 142 SVRLGC 147 >At2g14610.1 68415.m01643 pathogenesis-related protein 1 (PR-1) identical to GB:M90508 SP|P33154 Length = 161 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 578 INAWFDEVGKYGSKPITGGHGTGHYSQLVWGETSHVGC 691 +N W E Y T GHY+Q+VW ++ +GC Sbjct: 96 VNMWVSEKANYNYAANTCNGVCGHYTQVVWRKSVRLGC 133 >At2g14580.1 68415.m01633 pathogenesis-related protein, putative similar to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 161 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 578 INAWFDEVGKYGSKPITGGHGTGHYSQLVWGETSHVGC 691 +N W +E Y T GHY+Q+VW + +GC Sbjct: 96 VNLWVNEKANYNYDTNTCNGVCGHYTQVVWRNSVRLGC 133 >At5g57625.1 68418.m07199 allergen V5/Tpx-1-related family protein low similarity to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 207 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +2 Query: 548 SDSAPDFQKQINAWFDEVGKYG--SKPITGGHGTGHYSQLVWGETSHVGC 691 S AP F Q +W E Y + G GHY+Q+VW +T +GC Sbjct: 131 SSWAPGFAVQ--SWIVEGRSYNHNTNSCDGSGMCGHYTQMVWRDTKRLGC 178 >At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protein similar to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 210 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYGSKPIT--GGHGTGHYSQLVWGETSHVGC 691 + +W E Y T G GHY+Q+VW ET +GC Sbjct: 142 VESWTVEAKSYNHMTNTCEGDGMCGHYTQIVWRETRRLGC 181 >At5g26130.1 68418.m03108 pathogenesis-related protein, putative similar to PR-1a protein [Nicotiana tabacum] GI:19944; contains Pfam profile PF00188: SCP-like extracellular protein Length = 164 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKY--GSKPITGGHGTGHYSQLVWGETSHVGC 691 + W +E Y S + G GHY+Q+VW + VGC Sbjct: 97 VKLWVNEKSDYIYASNTCSDGKQCGHYTQVVWRTSEWVGC 136 >At4g33710.1 68417.m04787 pathogenesis-related protein, putative similar to PR-1a protein [Nicotiana tabacum] GI:19944; contains Pfam profile PF00188: SCP-like extracellular protein Length = 166 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYGSKPIT--GGHGTGHYSQLVWGETSHVGC 691 + W E Y K T G GHY+Q+VW + VGC Sbjct: 99 VRLWVREKSDYFHKSNTCRAGKQCGHYTQVVWKNSEWVGC 138 >At4g31470.1 68417.m04471 pathogenesis-related protein, putative similar to pathogenesis related protein-1 from Zea mays GI:3290004; contains Pfam profile PF00188: SCP-like extracellular protein Length = 185 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +2 Query: 578 INAWFDEVGKYGSKPITGGHGTG---HYSQLVWGETSHVGCGYXF 703 + AW E+ KY + + G HY+QLVW ++S +GC F Sbjct: 118 VAAWASEM-KYYDRRTSHCKANGDCLHYTQLVWKKSSRIGCAISF 161 >At4g30320.1 68417.m04310 allergen V5/Tpx-1-related family protein similar to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 161 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 587 WFDEVGKYGSKPIT-GGHGTGHYSQLVWGETSHVGCGY 697 W E Y + + GHY+Q+VW T +GC + Sbjct: 97 WLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCAH 134 >At4g33730.1 68417.m04789 pathogenesis-related protein, putative similar to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 172 Score = 30.7 bits (66), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 632 GHGTGHYSQLVWGETSHVGCG 694 G GHY+Q+VW ++ +GCG Sbjct: 125 GPACGHYTQVVWRGSARLGCG 145 >At2g19970.1 68415.m02335 pathogenesis-related protein, putative similar to pathogenesis-related protein 1 {Arabidopsis thaliana} GI:166805; contains Pfam profile PF00188: SCP-like extracellular protein Length = 177 Score = 30.3 bits (65), Expect = 1.7 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +2 Query: 485 ADSLXGQNLAATWATRPPTEPSD--SAPDFQKQINAWFDEVGKYGSKPITGGHGTGHYSQ 658 +D G+N+AA W +P D S P K W E Y GHY+Q Sbjct: 85 SDGPYGENIAAGWV-----QPKDQMSGPIAAKY---WLTEKPNYDHATNKCKDVCGHYTQ 136 Query: 659 LVWGETSHVGCG 694 +V ++ +GCG Sbjct: 137 MVANQSLSLGCG 148 >At4g33720.1 68417.m04788 pathogenesis-related protein, putative similar to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 163 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYG--SKPITGGHGTGHYSQLVWGETSHVGC 691 ++ W DE Y S GHY+Q+VW + +GC Sbjct: 96 VDMWVDEQFDYDYDSNTCAWDKQCGHYTQVVWRNSERLGC 135 >At1g50050.1 68414.m05616 pathogenesis-related protein, putative similar to pathogenesis-related protein 1b precursor (pr-1b) GB:X03465 GI:19977 from [Nicotiana tabacum]; contains Pfam profile PF00188: SCP-like extracellular protein Length = 226 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYG--SKPITGGHGTGHYSQLVWGETSHVGC 691 +N W +E Y + G HY+Q+VW + +GC Sbjct: 95 VNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIGC 134 >At5g01450.1 68418.m00058 expressed protein Length = 444 Score = 28.7 bits (61), Expect = 5.2 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 101 VIYETSNFFYYLNFPGIRCTM 39 V+Y+T+N +Y +FP +CT+ Sbjct: 255 VLYDTTNAYYNCSFPNDKCTL 275 >At5g66590.1 68418.m08394 allergen V5/Tpx-1-related family protein contains similarity to SP|Q41495 STS14 protein precursor {Solanum tuberosum}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 185 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 578 INAWFDEVGKYGSKPIT--GGHGTGHYSQLVWGETSHVGC 691 + W E Y K T H G Y Q+VW + +GC Sbjct: 117 VETWVKEKPFYNYKSDTCAANHTCGVYKQVVWRNSKELGC 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,601,511 Number of Sequences: 28952 Number of extensions: 400513 Number of successful extensions: 1031 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -