BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H13 (887 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY241928-1|AAO85277.1| 806|Caenorhabditis elegans xylosyltransf... 29 5.9 AJ496235-1|CAD42732.1| 806|Caenorhabditis elegans peptide O-xyl... 29 5.9 AC025722-4|AAK68509.3| 806|Caenorhabditis elegans Squashed vulv... 29 5.9 >AY241928-1|AAO85277.1| 806|Caenorhabditis elegans xylosyltransferase protein. Length = 806 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 4 LPGRNPRALCDIHCCLARILYH**VGGHIMFISDKVSSMT 123 LP N +A C HC A LY GH F + VS+ T Sbjct: 132 LPKSNGKATCRKHCYKAGFLYFGLEFGHECFCGNDVSNAT 171 >AJ496235-1|CAD42732.1| 806|Caenorhabditis elegans peptide O-xylosyltransferase protein. Length = 806 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 4 LPGRNPRALCDIHCCLARILYH**VGGHIMFISDKVSSMT 123 LP N +A C HC A LY GH F + VS+ T Sbjct: 132 LPKSNGKATCRKHCYKAGFLYFGLEFGHECFCGNDVSNAT 171 >AC025722-4|AAK68509.3| 806|Caenorhabditis elegans Squashed vulva protein 6 protein. Length = 806 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 4 LPGRNPRALCDIHCCLARILYH**VGGHIMFISDKVSSMT 123 LP N +A C HC A LY GH F + VS+ T Sbjct: 132 LPKSNGKATCRKHCYKAGFLYFGLEFGHECFCGNDVSNAT 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,853,582 Number of Sequences: 27780 Number of extensions: 320870 Number of successful extensions: 712 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -