BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H08 (819 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113427-1|AAI13428.1| 1048|Homo sapiens zinc finger protein 217... 31 3.8 AL157838-2|CAC08433.1| 1048|Homo sapiens zinc finger protein 217... 31 3.8 AF041259-1|AAC39895.1| 1048|Homo sapiens breast cancer putative ... 31 3.8 >BC113427-1|AAI13428.1| 1048|Homo sapiens zinc finger protein 217 protein. Length = 1048 Score = 31.5 bits (68), Expect = 3.8 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 8 FRTRHEDVAHVRTHDRDRRA-ARPPCLTFSAP*RGFSSSTLCA 133 FRT H+ V H R H +DRRA A P ++ G S L A Sbjct: 384 FRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTCSPDLAA 426 >AL157838-2|CAC08433.1| 1048|Homo sapiens zinc finger protein 217 protein. Length = 1048 Score = 31.5 bits (68), Expect = 3.8 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 8 FRTRHEDVAHVRTHDRDRRA-ARPPCLTFSAP*RGFSSSTLCA 133 FRT H+ V H R H +DRRA A P ++ G S L A Sbjct: 384 FRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTCSPDLAA 426 >AF041259-1|AAC39895.1| 1048|Homo sapiens breast cancer putative transcription factor protein. Length = 1048 Score = 31.5 bits (68), Expect = 3.8 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 8 FRTRHEDVAHVRTHDRDRRA-ARPPCLTFSAP*RGFSSSTLCA 133 FRT H+ V H R H +DRRA A P ++ G S L A Sbjct: 384 FRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTCSPDLAA 426 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,935,183 Number of Sequences: 237096 Number of extensions: 2856926 Number of successful extensions: 12492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12491 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10203625794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -