BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H07 (881 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 30 0.032 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 8.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 8.6 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 29.9 bits (64), Expect = 0.032 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = -2 Query: 241 PFLSCTKKIYYFVDKRPLYTFTCIDRHNTILIIFNIYGENAIALFLVYLYYFIAVVYKYN 62 PF +YF D +PL+ C D +I+ G ++ FL+ + +I ++ Sbjct: 27 PFCGPNVIDHYFRDLQPLFKLACTDTFMEGVIVLAFSGLFSVFSFLILVSSYIVILVNLR 86 Query: 61 N 59 N Sbjct: 87 N 87 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 681 RSRSIYPPTPFTSF 640 R R I PPTPF F Sbjct: 147 RFRCIGPPTPFPRF 160 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 681 RSRSIYPPTPFTSF 640 R R I PPTPF F Sbjct: 372 RFRHIGPPTPFPRF 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,947 Number of Sequences: 438 Number of extensions: 4321 Number of successful extensions: 42 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -