Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_FL5_H07
         (881 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g45160.1 68414.m05177 protein kinase family protein contains ...    28   7.2  

>At1g45160.1 68414.m05177 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719
          Length = 1067

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = -3

Query: 369 VRGPGLIPFIYSWVCSDIFCLFVILAYVSGYFTSLYTHRIRMD-LFCRVPKKYIILLIND 193
           VR P L+ F YS+ C D   L++++ Y++G    LY+   ++  L   + + YI  L+  
Sbjct: 725 VRYPFLVRFFYSFTCRD--NLYLVMEYLNG--GDLYSLLQKVGCLDEEIARIYIAELVLA 780

Query: 192 L-YTHSL 175
           L Y HSL
Sbjct: 781 LEYLHSL 787


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,292,608
Number of Sequences: 28952
Number of extensions: 274696
Number of successful extensions: 555
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 551
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 555
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2077687200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)