BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H05 (828 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 25 0.73 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 25.0 bits (52), Expect = 0.73 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 463 GTSSRTATLPSRKEGALPSTCPSRQTRPRQGICARTLPRLKRKF 594 G S RT + +K GA + + RPR L RLK +F Sbjct: 206 GRSPRTRRV--KKPGAKQGAPTAEEKRPRTAFSGAQLARLKHEF 247 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 426 DKRGRVGERALSRGRGFSF 370 D+RGR+G A R + SF Sbjct: 2121 DRRGRIGPYAYLRDQWVSF 2139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,350 Number of Sequences: 336 Number of extensions: 2930 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -