BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_H02 (829 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical p... 28 9.4 U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-... 28 9.4 >Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical protein C54D10.6 protein. Length = 348 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 204 VAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAFLLLG 88 + IAT ++S+I + ++ P+ +F C RC + G Sbjct: 283 LCLIATHGLLSTITTIMVHKPYRVFFFILCRRCLLMPAG 321 >U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-1 x-hybridizingprotein 1, isoform a protein. Length = 1876 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 701 KCLFPSPTLSRKRSQFQ*XTKLRCPTI 781 KCL+ +P+LS + QF T L CPT+ Sbjct: 1840 KCLYSTPSLSSQEHQF--LTCLPCPTM 1864 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,340,739 Number of Sequences: 27780 Number of extensions: 252958 Number of successful extensions: 823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -