BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G22 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 26 0.33 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 26 0.33 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 26 0.33 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 26 0.33 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.33 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 189 QLLVQHEEAWQLMMSQYHIAPHLLHTSLICLMMLKKVLLQSYLLTL 326 ++ ++H + W +M Y++ H L I + + +YLLTL Sbjct: 689 KMKIRHRKRWSQVMYMYYLLGHRLMELPISVDRKAVIAENTYLLTL 734 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.33 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 189 QLLVQHEEAWQLMMSQYHIAPHLLHTSLICLMMLKKVLLQSYLLTL 326 ++ ++H + W +M Y++ H L I + + +YLLTL Sbjct: 689 KMKIRHRKRWSQVMYMYYLLGHRLMELPISVDRKAVIAENTYLLTL 734 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.33 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 189 QLLVQHEEAWQLMMSQYHIAPHLLHTSLICLMMLKKVLLQSYLLTL 326 ++ ++H + W +M Y++ H L I + + +YLLTL Sbjct: 689 KMKIRHRKRWSQVMYMYYLLGHRLMELPISVDRKAVIAENTYLLTL 734 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.33 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 189 QLLVQHEEAWQLMMSQYHIAPHLLHTSLICLMMLKKVLLQSYLLTL 326 ++ ++H + W +M Y++ H L I + + +YLLTL Sbjct: 689 KMKIRHRKRWSQVMYMYYLLGHRLMELPISVDRKAVIAENTYLLTL 734 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 304 NSTFFNIIRQIRDVCNKWGAMW 239 N+ + + R VC K+GA+W Sbjct: 51 NTDTYPTLETCRLVCGKYGALW 72 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 482 HLE*TPQFVLSCHLLSSL 429 ++E P +L+CH+LS L Sbjct: 164 NIEPLPNVILACHMLSFL 181 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +3 Query: 15 WPLQARSQRRQNGSKPTSQA 74 WP A+ + ++ G KP++ + Sbjct: 1146 WPKSAKCEEKKPGHKPSTSS 1165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,653 Number of Sequences: 336 Number of extensions: 3306 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -