BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G21 (862 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_31222| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29963| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) 39 0.005 SB_17789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) 38 0.010 SB_13176| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 36 0.042 SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) 36 0.042 SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 35 0.098 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 34 0.13 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 34 0.13 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 34 0.17 SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) 33 0.23 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_35430| Best HMM Match : Vicilin_N (HMM E-Value=0.43) 32 0.69 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 32 0.69 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 32 0.69 SB_32651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 31 0.91 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 31 0.91 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 31 1.2 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_40784| Best HMM Match : TGF_beta (HMM E-Value=6.40393e-43) 31 1.6 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_20683| Best HMM Match : ROKNT (HMM E-Value=1.8) 31 1.6 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) 30 2.1 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 30 2.1 SB_19861| Best HMM Match : DUF465 (HMM E-Value=6.1) 30 2.1 SB_34272| Best HMM Match : L51_S25_CI-B8 (HMM E-Value=4.5) 30 2.8 SB_29083| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 30 2.8 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_20023| Best HMM Match : 7tm_1 (HMM E-Value=3.4e-25) 30 2.8 SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_29745| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.04) 30 2.8 SB_23194| Best HMM Match : IF_tail (HMM E-Value=1.26117e-44) 30 2.8 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 29 3.7 SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) 29 3.7 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 29 3.7 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_39075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) 29 3.7 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 29 3.7 SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) 29 3.7 SB_52107| Best HMM Match : DUF833 (HMM E-Value=1.6e-09) 29 4.9 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 29 4.9 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 29 4.9 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 29 4.9 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_17161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) 29 4.9 SB_7778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_57181| Best HMM Match : bZIP_1 (HMM E-Value=0.19) 29 6.4 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_42592| Best HMM Match : DUF1640 (HMM E-Value=1.7) 29 6.4 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 29 6.4 SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_23935| Best HMM Match : bZIP_Maf (HMM E-Value=0.76) 29 6.4 SB_12722| Best HMM Match : Oxysterol_BP (HMM E-Value=1.2) 29 6.4 SB_43856| Best HMM Match : Laminin_I (HMM E-Value=0.057) 29 6.4 SB_20798| Best HMM Match : DUF827 (HMM E-Value=0.85) 29 6.4 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 29 6.4 SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27) 29 6.4 SB_58550| Best HMM Match : DUF1065 (HMM E-Value=0.15) 28 8.5 SB_56371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) 28 8.5 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 28 8.5 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 28 8.5 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 28 8.5 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_56681| Best HMM Match : adh_short (HMM E-Value=0.035) 28 8.5 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 8.5 SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) 28 8.5 SB_50076| Best HMM Match : Filament (HMM E-Value=0.15) 28 8.5 SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_16342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/81 (33%), Positives = 42/81 (51%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 +K E+ ++ P P L K +RKKL+NR+AA R RK K E+E + Sbjct: 107 IKMEEQSQVVPHTPPLPPIDLDLQEAV---KNERKKLRNRLAASKCRKRKLEKEAELEDK 163 Query: 383 IRDFKEMNERLTSEVESLKAL 445 ++ K+ N +L SE + L+ L Sbjct: 164 VKVLKDKNTKLVSEAQELRRL 184 >SB_31222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 2/94 (2%) Frame = +2 Query: 227 ILDVASPSPSRKRRLDHLTWEE--KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKE 400 IL PSP + LT EE ++ K KN +AA+ +R +KK M+++E ++D K+ Sbjct: 158 ILTKPKPSPFN----EPLTEEELKDIEDKNKKNAIAARENRAKKKKYMEDLEKTVQDLKK 213 Query: 401 MNERLTSEVESLKALNERLISENTALREAAAAQS 502 N+ L + L+ E L E + + A QS Sbjct: 214 ENQELQTGHSKLQKTVEALNDEVSYYKNVLANQS 247 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/49 (36%), Positives = 30/49 (61%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 K +RKK +NR+A+ R RK + +E++++D KE N L + +LK Sbjct: 475 KRERKKQRNRIASSKCRKRKLEREARLENRVKDLKERNIELNAVANALK 523 >SB_29963| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) Length = 238 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 359 KMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTAL 478 +++E ESQI DFK E+ E++ L+ N+RL EN+AL Sbjct: 186 RIEEYESQIDDFKSKLEKANKELDQLRLDNQRLKDENSAL 225 >SB_17789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 K R+K+KN+++AQ SR +KK ++ +E ++ F N L V SL Sbjct: 164 KRIRRKIKNKLSAQESRRKKKEYVETLEKRLESFILENNTLRDRVSSL 211 >SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) Length = 298 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 4/70 (5%) Frame = +2 Query: 242 SPSP-SRKRRLDHLTWEEKMQR---KKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNE 409 +P P +K R + +EK R +++KN VAA+ SRD ++ K E+ + + ++ N Sbjct: 149 NPLPIGKKARRKFVPDQEKDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQLEKENA 208 Query: 410 RLTSEVESLK 439 RL E++ LK Sbjct: 209 RLREELQQLK 218 >SB_13176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 35.9 bits (79), Expect = 0.042 Identities = 18/67 (26%), Positives = 34/67 (50%) Frame = +2 Query: 314 KNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAA 493 + + A+ +R++KK + E+E + ++K N L + E +K L + L E L+ A Sbjct: 271 RQAIMAKINREKKKQYVQELEGSVEEYKSKNAVLQKDCEDMKGLVKDLQMEIAYLKGVLA 330 Query: 494 AQSVPGG 514 +S G Sbjct: 331 NESQLAG 337 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/49 (34%), Positives = 29/49 (59%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 K +RKK KNRVAA R +K + ++E +++ KE + L + +L+ Sbjct: 306 KRERKKQKNRVAASKCRRKKLEREAQLEVRVQQLKEKSIELNAVASALR 354 >SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) Length = 244 Score = 35.9 bits (79), Expect = 0.042 Identities = 22/67 (32%), Positives = 39/67 (58%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 ++K ++ +N VAA+ SRD K+ K + + ++ + NE+L +EV LK +RL + Sbjct: 178 DQKYWERRFENNVAAKRSRDLKRPKEMTVAKRAQNLEIENEKLRNEVTMLK---KRLQTL 234 Query: 467 NTALREA 487 N L E+ Sbjct: 235 NGKLDES 241 >SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 35.9 bits (79), Expect = 0.042 Identities = 20/74 (27%), Positives = 42/74 (56%) Frame = +2 Query: 224 MILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEM 403 ++L+ +PS ++ + T K + + +KNR AA+ R +KK + +E+++ + Sbjct: 220 IVLNQPGIAPSNQQIAEEAT--RKREMRLMKNREAAKECRRKKKEYVKCLENRVAVLENQ 277 Query: 404 NERLTSEVESLKAL 445 N+ L E+++LK L Sbjct: 278 NKTLIEELKALKDL 291 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 34.7 bits (76), Expect = 0.098 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Frame = +2 Query: 323 VAAQTSRDRKKAKMDE---MESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAA 493 V +T + +K+A + Q+ + K NE L ++ L+A+ R+ +EN + Sbjct: 1269 VTVETLQKQKQASEKNNRAISDQLAESKAQNEELRKNIQELQAIRSRIEAENADVNRQLE 1328 Query: 494 AQSVPGGQ-GPAESTPQQK 547 Q GGQ G A+ +Q+ Sbjct: 1329 EQENKGGQLGKAKKNLEQQ 1347 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/61 (21%), Positives = 30/61 (49%) Frame = +2 Query: 254 SRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVES 433 ++KR D + + ++ + L + A + R ++ +M EM+ ++ K+ +L E Sbjct: 1200 NKKRESDIIKLRKDLEEQALAHEQAVNSMRSKQNQQMQEMQEELDQVKKTKAKLEKEKAQ 1259 Query: 434 L 436 L Sbjct: 1260 L 1260 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/82 (29%), Positives = 45/82 (54%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 RKR+ + E+ +RK+ + AAQ + + + ++E + ++ +E ERL E E Sbjct: 256 RKRKEEAEKKREEEERKRREEEEAAQKWKKEELLRQQQLERE-KEEQERAERLQRERE-- 312 Query: 437 KALNERLISENTALREAAAAQS 502 +A+ ++E A EAAAA++ Sbjct: 313 EAMEAEDLAEEAAEAEAAAAEA 334 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/73 (34%), Positives = 36/73 (49%) Frame = +2 Query: 260 KRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 K+ L+H + K RK L + +R K + E +SQ+ + + E L S E K Sbjct: 2842 KQALEH---DLKETRKSLSG---VRDDLERVKREARESKSQLEELRGRVEDLESAEEFFK 2895 Query: 440 ALNERLISENTAL 478 NERL+ ENT L Sbjct: 2896 RENERLVRENTQL 2908 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 QTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 +T + + K+ +ES+I+D+K+ RL +EVESL + L E Sbjct: 2055 KTGVETTEKKVVSLESEIKDYKQSIYRLGTEVESLARERDSLTEE 2099 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEM--ESQIRDFKEMNERLTSEVESLKALNERLI 460 E ++Q + + + A+ R+++ K ++ E I D +RLT ++ S L ++L Sbjct: 862 EAQLQSTERREQELARQVREKQAYKQEQRKNEQDIDDKYRQIDRLTKDLNSKINLVDQLK 921 Query: 461 SENTALREAAAAQSVPGGQG 520 EN LRE + +G Sbjct: 922 RENHTLRERGVNSLIRENEG 941 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/67 (29%), Positives = 36/67 (53%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 EE+M++ + + R+AAQ + + K+ +E + Q R KE+ E E + E+ +E Sbjct: 198 EERMRKLQEEARLAAQRALEEKRKLEEERKEQERKEKELAELEKKRQEERRRQEEKRRAE 257 Query: 467 NTALREA 487 A R+A Sbjct: 258 EEAKRKA 264 Score = 32.7 bits (71), Expect = 0.39 Identities = 20/99 (20%), Positives = 46/99 (46%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIR 388 E + +D ++K+ +H+ ++ +R++ + + + +R+K + + + + + Sbjct: 355 ERQEALRIDRDRKQDAQKKVAEHVARLQEAERRRAEAKERERQEEERRKGEERQRQEEEK 414 Query: 389 DFKEMNERLTSEVESLKALNERLISENTALREAAAAQSV 505 KE ERL E E + +ER +E+ R Q V Sbjct: 415 RQKEEEERLRVEAERQREEDERQRAEDERQRAEDERQRV 453 Score = 28.3 bits (60), Expect = 8.5 Identities = 20/70 (28%), Positives = 35/70 (50%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 +KR+ + EEK + ++ R A + R+KA EME ++R K + ++E+ Sbjct: 241 KKRQEERRRQEEKRRAEEEAKRKAEEEKAAREKA---EMEEKLRRLKLQEKEEKRKLEAE 297 Query: 437 KALNERLISE 466 K ER+ E Sbjct: 298 KKEKERVERE 307 >SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) Length = 275 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 EK + ++ +N++AA R R+K + E+E + ++ N+ L E+ L ++L Sbjct: 174 EKRRIRRERNKLAAFKCRQRRKEHIQELEIESEGIEDSNKELEREISELHEQRQQL 229 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 33.5 bits (73), Expect = 0.23 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 4/84 (4%) Frame = +2 Query: 308 KLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTAL--- 478 K + AA +RDR+ A+ E E DF++ +E + E E+ K +ER+ EN + Sbjct: 405 KKSRKSAADFARDRELARKKEQEKHGSDFEDADEEVIVEEENEKE-SERIKEENENVEKE 463 Query: 479 -REAAAAQSVPGGQGPAESTPQQK 547 R A+ ++ G P + Q++ Sbjct: 464 QRTASKEKTASVGSKPKRYSSQRQ 487 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENT 472 K++ +KL+ + + + K A E+E + +D E E E LKA+ ++I Sbjct: 336 KIEAEKLQLQEKKDMAEEEKNAVAKELEKREKDLMEAEEEQNKLQERLKAVESKIIVGGV 395 Query: 473 ALREAAAAQSV 505 L E A Q + Sbjct: 396 NLLEKAKEQEL 406 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 32.3 bits (70), Expect = 0.52 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKA-KMDEMESQIRDFKEMNERLTSEVESLKALNERLIS 463 K R+ LKN A + K A + EME +I +E N++L SE+ K ++L S Sbjct: 476 KKDREDLKNECLALSETVTKIANEKREMEKEIEKLEEENKKLVSEINDFKVNIQKLES 533 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 32.3 bits (70), Expect = 0.52 Identities = 18/66 (27%), Positives = 36/66 (54%) Frame = +2 Query: 260 KRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 K RL+H EK RK R + + +++++E ++ +FK+ N+RL ++ + L Sbjct: 1351 KTRLEHT---EKELRKTEGERSSVYALNESSRSELEEFKNMNNNFKDENDRLKNQNDFLL 1407 Query: 440 ALNERL 457 + +RL Sbjct: 1408 SQGKRL 1413 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = +2 Query: 248 SPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEV 427 S +K R DH E + ++ + QTS +DE+ SQ+ ++ NE+L E+ Sbjct: 1221 STKQKWREDHQKLESLLTSPRVD--MGLQTSIIDTSV-VDEVSSQLSMSRQRNEKLEEEL 1277 Query: 428 ESLKALNERLISENTALREA 487 + K +R S+ +AL+ A Sbjct: 1278 KDTKEDVQRRRSDMSALKRA 1297 >SB_35430| Best HMM Match : Vicilin_N (HMM E-Value=0.43) Length = 238 Score = 31.9 bits (69), Expect = 0.69 Identities = 21/92 (22%), Positives = 45/92 (48%) Frame = +2 Query: 206 KEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQI 385 K++DS+ + A K+ D +T E+M+ ++ + + DRK +M+ Q+ Sbjct: 137 KQKDSEKVS--AMHDEREKKVQDLMTQMERMRAQQDQLTKRLREESDRKARLERDMQKQL 194 Query: 386 RDFKEMNERLTSEVESLKALNERLISENTALR 481 + KE+ ++ + + + LK E + + LR Sbjct: 195 QRVKELEQQTSQQQKVLKRKTEEVANVQRKLR 226 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 31.9 bits (69), Expect = 0.69 Identities = 26/112 (23%), Positives = 47/112 (41%), Gaps = 8/112 (7%) Frame = +2 Query: 140 EWSDYEKMSAPIIITVPNNYLVKEEDSDMILDVASPSPSRKRRLD----HLTWEEKMQRK 307 E K SA + + +V EE + V + R R ++ T+E+ ++ Sbjct: 1515 EMDQLRKKSADDLFSFEQQQIVGEEKLRYEMKVVNEKMKRDREVELNELKSTYEKDLENA 1574 Query: 308 KLKNRVAAQTSRDRKKAKMDEMESQIRDF---KEMN-ERLTSEVESLKALNE 451 ++KNR Q + K + + E ++ D K+ N ER+ V L L + Sbjct: 1575 RMKNREDVQAYETKLKETLRDYEGRLSDLTIEKQRNEERIKGLVRDLSTLKD 1626 Score = 29.9 bits (64), Expect = 2.8 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 2/96 (2%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKL--KNRVAAQTSRDRKKAKMDEME 376 VKE+ + D+ S R L+ L+ R +L + A + + +E Sbjct: 714 VKEKSEMLAQDMESIKVLHARELEKLSETYAGDRSRLLQDQKEATENHEQAMTEQRQRLE 773 Query: 377 SQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 SQI KE N ++ S V L + E ++ LRE Sbjct: 774 SQIEKLKEENGQMKSTVSGLASDVEMQRNKVKTLRE 809 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 31.9 bits (69), Expect = 0.69 Identities = 21/102 (20%), Positives = 42/102 (41%) Frame = +2 Query: 245 PSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSE 424 P +K++ ++K ++KK K + + + +KK K + + + + +E E E Sbjct: 146 PPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEEEEEEEEEEKE 205 Query: 425 VESLKALNERLISENTALREAAAAQSVPGGQGPAESTPQQKE 550 + + E E E A Q+ G G E ++ E Sbjct: 206 EKEEEEEEEEEEEEEEEEEEGCALQACDQGGGGEEEEKEEGE 247 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 31.9 bits (69), Expect = 0.69 Identities = 21/82 (25%), Positives = 41/82 (50%) Frame = +2 Query: 194 NYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEM 373 N L++E+ ++I D A + + E ++ K+L+N + + ++ + D+ Sbjct: 1258 NKLLQEQVENLIKDNALLQKDNTDKSTEIQNME-LEIKRLEN-IVSDLQKELENRPDDDW 1315 Query: 374 ESQIRDFKEMNERLTSEVESLK 439 + ++ K NE L EVESLK Sbjct: 1316 KEEVDGLKSRNEELLKEVESLK 1337 >SB_32651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 31.5 bits (68), Expect = 0.91 Identities = 23/64 (35%), Positives = 34/64 (53%) Frame = +2 Query: 272 DHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNE 451 DH+T +EK Q + KNR RDR + ++E KE + L S + +LK LN+ Sbjct: 570 DHVTPDEKYQHELNKNRAL----RDRIDSLTRDIELTESRIKEQH-TLISTLTTLKELNQ 624 Query: 452 RLIS 463 LI+ Sbjct: 625 ELIA 628 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 31.5 bits (68), Expect = 0.91 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDE-----MESQIRDFKEMNERLTSEVESLKALNE 451 + K+ ++ K+ A R+ K E MESQ+R KE L +V+ L+ N Sbjct: 949 QAKLHAEQFKSMSGANDEALREVNKSTEEFKSNMESQVRAAKEQASFLQGQVQGLEINNS 1008 Query: 452 RLISENTALREAAAAQ 499 L EN+ L+ + Q Sbjct: 1009 NLTVENSKLKRESERQ 1024 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 31.5 bits (68), Expect = 0.91 Identities = 21/90 (23%), Positives = 44/90 (48%), Gaps = 3/90 (3%) Frame = +2 Query: 170 PIIITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLT---WEEKMQRKKLKNRVAAQTS 340 PI + + + Y ++ SD + D +PS R +D LT WE K +++ + Q Sbjct: 576 PIKVDISDYYYSEDTRSDFLGD--APSGDRTGSIDSLTHEQWEGKQVEEQMDSLPHGQWE 633 Query: 341 RDRKKAKMDEMESQIRDFKEMNERLTSEVE 430 + + +MD + + + K++ E++ + E Sbjct: 634 GKQSEEQMDSLLHEQWEGKQVEEQMDKQGE 663 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 31.5 bits (68), Expect = 0.91 Identities = 18/61 (29%), Positives = 38/61 (62%), Gaps = 7/61 (11%) Frame = +2 Query: 332 QTSRDRKKAKMDEMESQIRDFK----EMNERLTSEVESLKALNE---RLISENTALREAA 490 ++ D K + E++++++ + E+N +L+++ ++LKA+ E RL SEN A+ E + Sbjct: 826 KSEEDGKNTSLAEVQNKMKSLQMTHEELNIKLSAQEKALKAMTEERDRLKSENEAMNELS 885 Query: 491 A 493 A Sbjct: 886 A 886 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 31.5 bits (68), Expect = 0.91 Identities = 21/90 (23%), Positives = 44/90 (48%), Gaps = 3/90 (3%) Frame = +2 Query: 170 PIIITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLT---WEEKMQRKKLKNRVAAQTS 340 PI + + + Y ++ SD + D +PS R +D LT WE K +++ + Q Sbjct: 524 PIKVDISDYYYSEDTRSDFLGD--APSGDRTGSIDSLTHEQWEGKQVEEQMDSLPHGQWE 581 Query: 341 RDRKKAKMDEMESQIRDFKEMNERLTSEVE 430 + + +MD + + + K++ E++ + E Sbjct: 582 GKQSEEQMDSLLHEQWEGKQVEEQMDKQGE 611 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL--TSEVESLKALNERLISE 466 K Q +KLK+ + + S++ K K+ EM++++ E ERL S E ++ + E Sbjct: 1169 KEQEEKLKDDI--RKSKEYNKEKIREMQNELFKHNEKQERLKGVSSQEDIERIAELTDGS 1226 Query: 467 NTALRE 484 NT +E Sbjct: 1227 NTPAKE 1232 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/107 (18%), Positives = 50/107 (46%) Frame = +2 Query: 173 IIITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRK 352 + +T + V E + ++ ++P + L + E++ + K+ T ++ Sbjct: 200 LFLTGTLTFSVSELEVYRVVKESAPHVKEDQSLKEVAKEDEPLNQVTKDEFV--TKMEKL 257 Query: 353 KAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAA 493 +AK DEM +I +F+E + ++ L+ + + +E+ LR + + Sbjct: 258 RAKKDEMLKKIEEFEEREKAAMKKIARLEEVIAKDKNESATLRRSCS 304 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 299 QRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 QRK+++N+ AA R +KK + + + ++ N +L EV SL Sbjct: 449 QRKRVQNKDAATRYRVKKKDEQSRLFDEAEKLEKENNKLKDEVGSL 494 >SB_40784| Best HMM Match : TGF_beta (HMM E-Value=6.40393e-43) Length = 1402 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/93 (23%), Positives = 39/93 (41%) Frame = +2 Query: 200 LVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMES 379 +V+EE ++ + + + L + +K K +AQT ++ KA+++E E Sbjct: 170 VVREEKIELATRYDDKAKELDQLKEDLLAKTGFAEEKSKELNSAQTQIEKLKAQLEEREW 229 Query: 380 QIRDFKEMNERLTSEVESLKALNERLISENTAL 478 I FKE L +E + L E L Sbjct: 230 TIASFKEQGANLAQILERNNQTGDSLQRERQEL 262 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/93 (23%), Positives = 39/93 (41%) Frame = +2 Query: 200 LVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMES 379 +V+EE ++ + + + L + +K K +AQT ++ KA+++E E Sbjct: 476 VVREEKIELATRYDDKAKELDQLKEDLLAKTGFAEEKSKELNSAQTQIEKLKAQLEEREW 535 Query: 380 QIRDFKEMNERLTSEVESLKALNERLISENTAL 478 I FKE L +E + L E L Sbjct: 536 TIASFKEQGANLAQILERNNQTGDSLQRERQEL 568 >SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/76 (23%), Positives = 34/76 (44%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIR 388 E D D I D + S + + EE+ + ++ +N+VAA R ++K + + Sbjct: 72 EVDMDYIYDTSLHSGAESTEMVTPEEEERRKLRRERNKVAASKCRQKRKQHVRNLVQVSE 131 Query: 389 DFKEMNERLTSEVESL 436 + N L S++ L Sbjct: 132 ALEVQNNTLQSQITKL 147 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 314 KNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 ++R ++ KAKM EME +KE N+RL SE+ +L Sbjct: 2300 ESRTKIESEIKSTKAKMCEMEITNEAYKEENDRLRSEIIAL 2340 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +2 Query: 284 WEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLIS 463 W +KM K RD KAK++E E + KE E ++++ + L +S Sbjct: 3129 WNDKMMELK-SQFTRTSDERDDLKAKLEETEETLASTKENLEETSTKLSETEKLRSSEVS 3187 Query: 464 E 466 E Sbjct: 3188 E 3188 >SB_20683| Best HMM Match : ROKNT (HMM E-Value=1.8) Length = 110 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = +2 Query: 209 EEDSDMILDVASP-SPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQI 385 +EDS++ + S S + DH T E+ +K+KNR A T R ++ + E Q Sbjct: 9 DEDSNVSTETFEDYSDSESSQSDHTTNEDSSSDEKVKNRDANGTLRKKRTCLYN--EEQN 66 Query: 386 RDFKEMNERLTSEVESLK 439 F + + L + ++S++ Sbjct: 67 VPFSKSTKELLALIDSIR 84 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 1/93 (1%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTS-RDRKKAKMDEMESQI 385 E+D + + + +R + + L K + K K R+ + ++ K ++ + +QI Sbjct: 2624 EKDVESLRKEMNDDKNRAYKQETLIQSIKTENDKFKKRLEQEIKDKENKNLELQRLTNQI 2683 Query: 386 RDFKEMNERLTSEVESLKALNERLISENTALRE 484 DFK + V++ + + + E LRE Sbjct: 2684 EDFKTKLSEVEGRVKAANSEKKTIEDEVKKLRE 2716 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = +2 Query: 359 KMDEMESQIRDFKEMNERLTSEVESLKALNER----LISENTALRE 484 ++ ++++I + + NE L ++ NER LISEN+ LRE Sbjct: 1253 EVQSLQTRISELQRENENLKQTIQETSDKNERRVEELISENSKLRE 1298 >SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 4/84 (4%) Frame = +2 Query: 269 LDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE--MESQIRDFKEMNERLTSEVESLKA 442 LDH+ K+Q ++ K + + RDR++ + ++ +++++ + +E+ LT EVE + Sbjct: 190 LDHV----KIQMQQFKEDFSCER-RDRERVQKEKECIQAELANAQEIIATLTQEVEMYRE 244 Query: 443 LNERLISENTAL--REAAAAQSVP 508 R+ EN L R +A QS P Sbjct: 245 HCLRIQEENAVLRRRHSAPVQSQP 268 >SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) Length = 1102 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/67 (26%), Positives = 33/67 (49%) Frame = +2 Query: 233 DVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNER 412 D+ + +R+DH+TW+ +M KK+++ A +S K +S I D E Sbjct: 783 DLKKENMDLAKRIDHMTWKSEMMEKKMQD--MASSSLMMNKVITTTTDS-INDLNEEMTE 839 Query: 413 LTSEVES 433 L ++E+ Sbjct: 840 LKIQLET 846 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = +2 Query: 266 RLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKAL 445 RLD L K KN R + ++DE++ + +N+ L + E +KAL Sbjct: 361 RLDELEDVCSENEKLSKNNKQKDEKIQRLQERLDEVQDAVNMNANLNKSLKNRDEKIKAL 420 Query: 446 NERLI 460 +R++ Sbjct: 421 GKRIL 425 >SB_19861| Best HMM Match : DUF465 (HMM E-Value=6.1) Length = 75 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/46 (36%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +2 Query: 365 DEMESQIRDFKEMNERLTSEVESLKALNE---RLISENTALREAAA 493 ++M+S +E+N +L+++ ++LKA+ E RL SEN A+ E +A Sbjct: 9 NKMKSLQMTHEELNIKLSAQEKALKAMTEERDRLKSENEAMNELSA 54 >SB_34272| Best HMM Match : L51_S25_CI-B8 (HMM E-Value=4.5) Length = 178 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 226 DSRCSVTVSVQETATGPSDMGR-KNAKKETEKSRGSTDFSRQKESQDGRN 372 +S+C T SV +T S G+ +N+KKET R S+ K + N Sbjct: 112 NSKCHPTPSVHNYSTDHSKCGKQRNSKKETLDKRKEAILSKNKNAAKSAN 161 >SB_29083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 ++++ + K +N + +T+RD + K D++E + E NE+L E + L + + Sbjct: 29 KQEIDQLKEENFIL-ETARDEYRIKADQLERDVEILNEKNEQLQGLAEESQQLKDEM 84 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 ++++ + K +N + +T+RD + K D++E + E NE+L E + L + + Sbjct: 459 KQEIDQLKEENFIL-ETARDEYRIKADQLERDVEILNEKNEQLQGLAEESQQLKDEM 514 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKR-RLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQI 385 + +S + V P + R +L E + + KL+ + + +RK + E QI Sbjct: 1086 DTESSTNIQVTETDPIKLREKLQEALIEVQQYKVKLEQAMQDKEKLERKLSSFSEDIKQI 1145 Query: 386 RDFKEMNERLTSE 424 D K N+RL E Sbjct: 1146 NDLKAENQRLKDE 1158 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENT 472 K++ K + + Q + + + M + E R +E + ++ LKA N+RL EN Sbjct: 1102 KLREKLQEALIEVQQYKVKLEQAMQDKEKLERKLSSFSEDI-KQINDLKAENQRLKDENG 1160 Query: 473 ALREAAAAQSVP 508 AL + S P Sbjct: 1161 ALIRVISKLSKP 1172 >SB_20023| Best HMM Match : 7tm_1 (HMM E-Value=3.4e-25) Length = 548 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 125 VFSLIEWSDYEKMSAPIIITVPNNYLVKEEDSDMILDVASPSP 253 +++L W+D K API T+ N+ L + +S ++ P+P Sbjct: 284 LYNLPHWADPRKRPAPITTTITNHRLNRHTNSVILSSRKRPAP 326 >SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 29.9 bits (64), Expect = 2.8 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = +2 Query: 248 SPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEV 427 S S RL L+ E +Q + K + A + R R + ++ + RD+ ER+ + Sbjct: 452 SSSASDRLTMLSRERTLQEEAEKWQQAWKDERRRNDKLISDIAVRERDWSRAEERMRQDY 511 Query: 428 E-SLKALNERLISENTALRE 484 E L L + + S LRE Sbjct: 512 EQQLSDLKQEVFSLTARLRE 531 >SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +2 Query: 344 DRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTAL 478 D +AK EME +IRDF +N T SL A+ ++ + E AL Sbjct: 1133 DAHQAKRKEMEVEIRDF--INAFCTELTVSLSAMKQQHLREQLAL 1175 >SB_29745| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.04) Length = 1481 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +2 Query: 341 RDRKKAKMDEMESQIRDFKEMNERLTSE---VESLKALNERLISENTALR 481 RD K+ E E D K+ N R+ + + L A N RL+SE+ ALR Sbjct: 463 RDELSLKLQEYEDA-PDLKKANHRIRQQELRINELLAENARLVSESGALR 511 >SB_23194| Best HMM Match : IF_tail (HMM E-Value=1.26117e-44) Length = 788 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAK-MDEMESQIRDFKEMNERLTSEVESLKAL 445 E ++QR++ +A +R +K +DE+ SQ+ + N L S V L+ L Sbjct: 465 ELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGL 518 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.9 bits (64), Expect = 2.8 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 7/97 (7%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSR-KRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RK--- 352 N++ K + + L+ A R K+ LD T EK+QR K + +A ++ RK Sbjct: 821 NSFAAKAQSFEKQLEAAVKEKDRYKKELD--TSLEKVQRNKEETLMAQSLVQEKGRKLAS 878 Query: 353 -KAKMDEMESQIRDFKEMNERLTSEVESLKALNERLI 460 +++MDE E+QIR +N + E ++ K E+++ Sbjct: 879 YRSEMDEKENQIRSL--LNRIDSVEKDNTKLKKEKVV 913 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/83 (25%), Positives = 38/83 (45%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 VKEE M + + RL EE+++++K + ++ + RD + + E+E Q Sbjct: 229 VKEEALAMEVQKELEAEMEMERLQKENEEERLRKEKEERKMEEERRRDEQARRDRELEDQ 288 Query: 383 IRDFKEMNERLTSEVESLKALNE 451 R K+ RL E + + E Sbjct: 289 QR--KDEERRLIMEQQERERRQE 309 >SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 232 RCSVTVSVQETATGPSDMGRKNAKKETEKSRGSTDFSRQKESQDGRNGESDKG 390 RC VT ++ T P D G++NAK + FS K+ Q N ++ G Sbjct: 521 RCGVT----DSPTVPDDKGKRNAKGRPMSMFVGSFFSANKDKQQSINNNNNVG 569 >SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) Length = 1001 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/101 (19%), Positives = 43/101 (42%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 +KE DS+ A +++L L E K + K + ++ ++ ++ Sbjct: 700 IKEHDSESSKQAAKLKEEYEKKLGGLQTELKKVQAAKKEHAQLIREKANNDMRLKQLSNE 759 Query: 383 IRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSV 505 + D K+ RL +++ A N++ E+ +E A + V Sbjct: 760 VSDMKKTKARLMKQMKDEVAKNKQ--RESARNKEIAQLKKV 798 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/59 (25%), Positives = 29/59 (49%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 +K + ++ VAA + D + + +ME + K+ + L E++ LKA L +E Sbjct: 994 QKAADEAKRDLVAANVAADAAREEKRDMERKFNSLKDRIDALEKEIKELKAQRNNLETE 1052 Score = 28.3 bits (60), Expect = 8.5 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Frame = +2 Query: 302 RKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEV----ESLKALNERLISEN 469 RK ++ +AAQ+S +K+ +++ + +++D + ERL S E L L L++ Sbjct: 1089 RKMKEDLLAAQSSLKQKEREVETKDKELKDKDAIIERLRSAKAVTDEELLNLKRELMNTK 1148 Query: 470 TALREA 487 AL A Sbjct: 1149 NALEAA 1154 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 5/91 (5%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSR-----DRKKAKMDEM 373 ++ S + + S K ++ L E ++ K+ R+ +Q R D A+ +M Sbjct: 2315 DKKSKKLERITKESKDLKEKVTSLEEELRLSNKQ-SERLTSQVQRLERDLDEAAAQKSDM 2373 Query: 374 ESQIRDFKEMNERLTSEVESLKALNERLISE 466 E +I ++ R+ EV L NERL +E Sbjct: 2374 EDRIATLEKRYVRMQHEVTGLNDDNERLETE 2404 >SB_39075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 2/79 (2%) Frame = +2 Query: 254 SRKRRLD-HLTWEEKMQRKKLKNRVAAQTSRDRKK-AKMDEMESQIRDFKEMNERLTSEV 427 S K+R D H W MQR K +NR+ RD K+ A D+ ++IRD K R + Sbjct: 32 SDKQRYDVHRYWLGDMQRDKHRNRI-----RDNKRHAIRDKHRNRIRDNKRHAIR-DKHI 85 Query: 428 ESLKALNERLISENTALRE 484 + ++ + ++I + ++ + Sbjct: 86 QRIRDKHRQMIRDKVSISD 104 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/99 (22%), Positives = 42/99 (42%) Frame = +2 Query: 254 SRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVES 433 SR RL K+ K K A+ + ++ + ++E + + + F+E + L E Sbjct: 1536 SRHTRLISKYTRLKLDYKSSKG--VAKRNAEKLRTALNERKDREKAFQEKVKALKQECLH 1593 Query: 434 LKALNERLISENTALREAAAAQSVPGGQGPAESTPQQKE 550 LK +N+R+ + RE + ++ P KE Sbjct: 1594 LKGINDRIAVTKSGRRETVEIHLKGNNEVESKDRPTLKE 1632 >SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) Length = 672 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 EK++R+ R A Q +RD + K D+++ Q + F+E E+ E++ L + S+ Sbjct: 83 EKIRREYEVFR-AQQANRDSRTPKRDKVQRQFKIFREAKEQ---EIQDLLTAKRAVESK- 137 Query: 470 TALREAAAAQSVPGGQGPA 526 L+ AQ G G A Sbjct: 138 --LQHVLTAQGYEEGHGAA 154 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/95 (17%), Positives = 40/95 (42%) Frame = +2 Query: 194 NYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEM 373 N V++ED+D L V P ++ + + K++ + KN+ + D + K + Sbjct: 535 NNTVEDEDADEFLVVPKPPTPVQKTVFQKVFNTKIKERPKKNKSPGKAQEDALQTKAVQK 594 Query: 374 ESQIRDFKEMNERLTSEVESLKALNERLISENTAL 478 + I ++ +L + ++++ E L Sbjct: 595 KQVIMKQQQQQLQLLTSPNEFDLFKQQVLHEQERL 629 >SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) Length = 241 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKA---KMDEMESQIRDFKE 400 LD+ PSPS D EEK +R ++ Q + +++A K E+E + K Sbjct: 162 LDLLVPSPSSSSG-DSDKSEEKRKRNNQASKKFRQARKGKQQALFAKESELERENYSLKV 220 Query: 401 MNERLTSEVESLKA 442 E+L E+ LKA Sbjct: 221 QVEQLIRELNQLKA 234 >SB_52107| Best HMM Match : DUF833 (HMM E-Value=1.6e-09) Length = 624 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +2 Query: 368 EMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 +ME ++ + RL SE++ LKA+NERL+++ RE Sbjct: 326 QMEWKLGCAENEISRLGSELQELKAVNERLVTQLRNSRE 364 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/65 (23%), Positives = 32/65 (49%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 RK+ + EKM ++K K R + + + + ++ E E +R+ + + E+E + Sbjct: 969 RKKIMKEQRELEKMLQQKEKERQVERQKQKQLQEQLQEQEKALRERLQRQQEELEEIEKV 1028 Query: 437 KALNE 451 K L + Sbjct: 1029 KQLEK 1033 >SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) Length = 721 Score = 29.1 bits (62), Expect = 4.9 Identities = 26/102 (25%), Positives = 50/102 (49%) Frame = +2 Query: 200 LVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMES 379 + ++ D + SP++K + +K L+ + +T D+KKA + ++S Sbjct: 128 MTRKRAKDKVSPSLPTSPAKKAEVLENLVNSPRTKKILERKNVLRTDEDKKKA--EAVQS 185 Query: 380 QIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSV 505 + D M+E L S+V+ KA++ER + +A R A S+ Sbjct: 186 LLED---MSEGL-SKVKQSKAVDER--AAYSAARSLAFGSSI 221 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 7/72 (9%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKA-------L 445 EE + K K + +R+ ++ K + + +D+ M E L S +E KA + Sbjct: 184 EELRENLKAKQAILEDINRENQELKSHKGSTPNQDYVSMIEELKSNLEIKKAALEDLNRM 243 Query: 446 NERLISENTALR 481 NE L +EN L+ Sbjct: 244 NEHLDAENKQLK 255 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 281 TWEEKMQRKK--LKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNE 409 T +E+ +RKK KN+ + ++RKK + +E E + R+ +E E Sbjct: 411 TTDEEKERKKSETKNKDSEDEEKERKKREAEEEEERRREEEERRE 455 >SB_17161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RKKAKMDEMESQIRDFKEM 403 L ++S S ++RLD L Q+KKL R + + D K+ + ++ + K++ Sbjct: 40 LKISSESVLLEKRLDDLCRRSSAQKKKLNVRGSVKQRLDFCTSACKVRLLRKEVVEIKDL 99 Query: 404 NERLTSEVESLKALNE 451 E E S+ +E Sbjct: 100 VEERVEETSSIAERDE 115 >SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +2 Query: 305 KKLKNRVAAQTSRDRKKAKMDEMESQIRD---FKEMNERLTSEVESLKALN 448 KKLK R A+ +DRK+ +D+M+ +R+ K+ +RL E +S K+++ Sbjct: 530 KKLKQRTKAK-DKDRKRKLVDKMKPGLRNKYAKKDALDRLEKESKSSKSVS 579 >SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) Length = 558 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RKKAKMDEMESQIRDFKEM 403 L ++S S ++RLD L Q+KKL R + + D K+ + ++ + K++ Sbjct: 290 LKISSKSVLLEKRLDDLCRRSSAQKKKLNVRGSVKQRLDFCTSACKVRLLRKEVVEIKDL 349 Query: 404 NERLTSEVESLKALNE 451 E E S+ +E Sbjct: 350 VEERVEETSSIAERDE 365 >SB_7778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/66 (27%), Positives = 37/66 (56%) Frame = +2 Query: 269 LDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALN 448 LD+ +W KM++ K K+++ K+AK +E+ES R+++ +N +L E+ + Sbjct: 113 LDYDSWSNKMEKIKDKDKL--------KQAK-EELESAKRNYEALNAQLLEELPLFRQKT 163 Query: 449 ERLISE 466 L+ + Sbjct: 164 MSLVKD 169 >SB_57181| Best HMM Match : bZIP_1 (HMM E-Value=0.19) Length = 104 Score = 28.7 bits (61), Expect = 6.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +2 Query: 314 KNRVAAQTSRDRKKAKMD---EMESQIRDFKEMNERLTSEVESLKALNERLISENTALR 481 K ++ +++ R D E E R+++ +E+ L+ LNE+L SEN LR Sbjct: 5 KGKIVSKSDSLRSALSFDFDSETEKIRREYEVFRVSKQTEIAELQVLNEKLQSENRRLR 63 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 28.7 bits (61), Expect = 6.4 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +2 Query: 299 QRKKLKNRVAAQTSRDRKKAKMDEMESQI-RDFKEMNERLTSEVESLKALNERLISE 466 + +K K V A ++ AK E+E + + KEM L S+ E +KAL + + E Sbjct: 222 EMRKDKAEVVALMQKEISAAKDSELEKALAKKEKEMEALLASKEEHMKALLDEKVKE 278 >SB_42592| Best HMM Match : DUF1640 (HMM E-Value=1.7) Length = 420 Score = 28.7 bits (61), Expect = 6.4 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RKKAKMDEMESQIRDFKEM 403 L ++S S ++RLD L Q+KKL R + + D K+ + ++ + K++ Sbjct: 98 LKISSKSVLLEKRLDDLCRRSPAQKKKLNVRGSVKPRFDFCTSACKVRLLRKEVVEIKDL 157 Query: 404 NERLTSEVESLKALNE 451 E E S+ +E Sbjct: 158 VEERVEETSSIAGRDE 173 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = +2 Query: 272 DHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNE 451 D L E + RK+L +RV ++ +++++ + D E + E+E LK +NE Sbjct: 33 DRLDNENQKLRKELADRVDQNEILLKQVKELEKVRDEQMDDLEDQYK---EIEHLKEINE 89 Query: 452 RLISENTALREA 487 L + N L +A Sbjct: 90 ELNNRNVELSKA 101 >SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/76 (19%), Positives = 36/76 (47%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 +++ + H + + +K + + AAQT + + K+D S +RDF++ + L + Sbjct: 370 KEKEMQHRLMHQDLTKKMHQEQQAAQTLQQELQGKLD---SALRDFEKQKQLLADAKRTE 426 Query: 437 KALNERLISENTALRE 484 +L + + + E Sbjct: 427 SSLESAIKGKEHTITE 442 >SB_23935| Best HMM Match : bZIP_Maf (HMM E-Value=0.76) Length = 715 Score = 28.7 bits (61), Expect = 6.4 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +2 Query: 359 KMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGPAESTP 538 K++E+E ++RD + N L ES K L + + ++N L A Q +ST Sbjct: 191 KLEELEKEVRDLQNRNRALE---ESYKKLTDLVEAQNHLLSSGAPLLQHIHAQSAIQSTR 247 Query: 539 QQ 544 ++ Sbjct: 248 EE 249 >SB_12722| Best HMM Match : Oxysterol_BP (HMM E-Value=1.2) Length = 640 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = +1 Query: 256 QETATGPSDMGRKNAKKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGEL 435 +E+ T GR A +E+ SR + S++ +D +NG S+ +R + S + + Sbjct: 344 KESKTSTIREGRM-ALRESSSSRVGKESSKRSPDRDEKNGRSNGSPKREKHRSDRKRDKE 402 Query: 436 ESFEREVD 459 ES ER+ D Sbjct: 403 ESRERDRD 410 >SB_43856| Best HMM Match : Laminin_I (HMM E-Value=0.057) Length = 976 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 ++ +RK ++N + D + +E+ I++ RLT E+ ERL +E Sbjct: 73 DRFRRKVIQNVFINKKIPDCGEMDDEELLDSIKELSHDTVRLTDEIRGYADAEERLHNEK 132 Query: 470 TALREA 487 L++A Sbjct: 133 NDLKDA 138 >SB_20798| Best HMM Match : DUF827 (HMM E-Value=0.85) Length = 329 Score = 28.7 bits (61), Expect = 6.4 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RKKAKMDEMESQIRDFKEM 403 L ++S S ++RLD L Q+KKL R + + D K+ + ++ + K++ Sbjct: 64 LKISSESVLLEKRLDDLCRRSSAQKKKLNVRGSVKQRLDFCTSACKVRLLRKEVVEIKDL 123 Query: 404 NERLTSEVESLKALNE 451 E E S+ +E Sbjct: 124 VEERIEETSSIAERDE 139 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = +2 Query: 272 DHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNE 451 D L E + RK+L +RV ++ +++++ + D E + E+E LK +NE Sbjct: 770 DRLDNENQKLRKELADRVDQNEILLKQVKELEKVRDEQMDDLEDQYK---EIEHLKEINE 826 Query: 452 RLISENTALREA 487 L + N L +A Sbjct: 827 ELNNRNVELSKA 838 >SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27) Length = 335 Score = 28.7 bits (61), Expect = 6.4 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 4/98 (4%) Frame = +1 Query: 232 RCSVTVSVQETA--TGPSDMGRKNAKKETEKSRGSTDFSRQKESQD--GRNGESDKGFQR 399 RC VT Q+ + TGP D ++ + ++ + + +++Q+ G G D + Sbjct: 214 RCPVTQDTQKMSGYTGPQDTQEMSSYTGPQDTQEMSSYMGPQDTQEMSGYTGRQDTQ-EM 272 Query: 400 NE*ASHK*GGELESFEREVD*REHSATRSGGGAERPGW 513 + + E+ S+ D +E SAT + GG W Sbjct: 273 SGYTGPQDTQEMSSYMGPQDTQEMSATTTSGGMAHTDW 310 >SB_58550| Best HMM Match : DUF1065 (HMM E-Value=0.15) Length = 624 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 451 LVQSFQALHLTCETLIHFFE-IPYLTLHFVHLGFLSVARSLCCHAIFQFLSLHFFF 287 LV + + C + F + + +TL F L++A LC + +FLS+H F Sbjct: 260 LVVFLSLIGIACHIIAVFLDDMDRVTLIFARNQILALAMVLCVVQLLEFLSIHQLF 315 >SB_56371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +2 Query: 260 KRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRD-FKEMNERLTSEVESL 436 ++RLD L W ++ ++ ++++V R K K + + ++RD K+ +R+ V+ Sbjct: 400 RQRLDDLHWLDEETKQHVRDKVKQTKQHVRDKVK--QTKQRVRDRVKQTKQRVRDRVKQT 457 Query: 437 K 439 K Sbjct: 458 K 458 >SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) Length = 874 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 E+ +LK RV + + ++ +M + KE+ E+ E+ESLK N+ L Sbjct: 458 EKNAMMAELKTRVEELKMENEYQLRLKDMNYNEK-IKELTEKFIQEMESLKTKNQVL 513 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 28.3 bits (60), Expect = 8.5 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 ++R +++L + KKLK R+ + KK +E ++ K L SEV++L Sbjct: 58 KEREINNLRKTRNDEVKKLKERI--HVLEEEKK----RLEEELASVKYKLTALESEVKAL 111 Query: 437 KALNERLISENTALREAAA 493 N+R E L E A Sbjct: 112 SNANDRQEEEKQKLAEKLA 130 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +1 Query: 250 SVQETATGPSDMGRKNAKKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*AS 414 ++ + +TG + +K K+ K R S D + K + + D G ++ E AS Sbjct: 529 TIDQPSTGETKKHKKRKHKKKHKRRKSKDGGKFKAGESTADSHEDSGKEQEEDAS 583 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 28.3 bits (60), Expect = 8.5 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 4/101 (3%) Frame = +2 Query: 140 EWSDYEKMSAPIIITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQ---RKK 310 E + K SA + T PNN + + +S+ ++ P R + T ++ ++ +KK Sbjct: 532 EVDEMVKQSAVVKETKPNNVIEETVESETTVNGLESDPERLKSSQGTTVDQSVKDVPKKK 591 Query: 311 LKNRVAAQTSRDRKKAKMDEMESQI-RDFKEMNERLTSEVE 430 K + Q +++ K D M++ R KE+++ +E E Sbjct: 592 KKGKQRFQ-EMEKRSDKADLMDAYTERPEKEVSKEPQTEQE 631 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 28.3 bits (60), Expect = 8.5 Identities = 20/83 (24%), Positives = 38/83 (45%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 VKEE M + + RL EE++++++ + ++ + RD + + E+E Q Sbjct: 1415 VKEEALAMEVQKELEAEMEMERLQKENEEERLRKEEEERKMEEERRRDEQARRDKELEDQ 1474 Query: 383 IRDFKEMNERLTSEVESLKALNE 451 R K+ RL E + + E Sbjct: 1475 KR--KDEERRLIMEQQERERRQE 1495 >SB_56681| Best HMM Match : adh_short (HMM E-Value=0.035) Length = 437 Score = 28.3 bits (60), Expect = 8.5 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRD--RKKAKMDEMESQIRDFKEM 403 L ++S S ++RLD L Q+KKL R + + D K+ + ++ + K + Sbjct: 285 LKISSESVLLEKRLDDLCRRSSAQKKKLNVRGSGKPRFDFCNSACKVRLLRKEVVEIKNL 344 Query: 404 NERLTSEVESLKALNE 451 E E S+ +E Sbjct: 345 VEERVEETSSIAERDE 360 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 28.3 bits (60), Expect = 8.5 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 353 KAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQS 502 K K +E + DF E E L +++ L NE L S+ LREA +A S Sbjct: 1863 KRKENEQSENVDDF-ESGEELQLKIKELNEKNESLSSQ---LREAISANS 1908 >SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) Length = 311 Score = 28.3 bits (60), Expect = 8.5 Identities = 23/66 (34%), Positives = 30/66 (45%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 +EK Q K K ++ + R K+ K E + R KE ERL E E L ERL E Sbjct: 241 KEKEQLNKEKEQLNKERKRLNKERKRVNKERE-RLNKE-KERLNKETERLDKTRERLNKE 298 Query: 467 NTALRE 484 L + Sbjct: 299 RKRLNK 304 >SB_50076| Best HMM Match : Filament (HMM E-Value=0.15) Length = 380 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/76 (22%), Positives = 40/76 (52%) Frame = +2 Query: 278 LTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 +T +E ++ +K N++AA+ ++ EM+ ++ + + NE+ E+ES K N+ + Sbjct: 113 VTRDEMLKVEKSYNQMAAE--KEELHNDYIEMQRKLEELWQDNEKYKKEIESQKKTNQLM 170 Query: 458 ISENTALREAAAAQSV 505 ++ A + Q + Sbjct: 171 KAKYDAQVDGLNKQKI 186 >SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 28.3 bits (60), Expect = 8.5 Identities = 23/66 (34%), Positives = 30/66 (45%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 +EK Q K K ++ + R K+ K E + R KE ERL E E L ERL E Sbjct: 500 KEKEQLNKEKEQLNKERKRLNKERKRVNKERE-RLNKE-KERLNKETERLDKTRERLNKE 557 Query: 467 NTALRE 484 L + Sbjct: 558 RKRLNK 563 >SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 8.5 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = +2 Query: 320 RVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKAL----NERLISENTALREA 487 R Q K+ ++ + QIR E E+ EVE L+ L E+ E AL++A Sbjct: 266 RAHLQNQLRTKEMDINRQQVQIRSMNEQLEQSQLEVEHLQGLLAASREKSAREKEALKKA 325 Query: 488 AAAQ 499 A Q Sbjct: 326 ARVQ 329 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 277 SDMGRKNAKKETEKSRGSTDFSRQKESQ-DGRN 372 SD KKE + RGSTD SR S+ D +N Sbjct: 343 SDFSYSKGKKEGKDKRGSTDDSRSSRSKGDSQN 375 >SB_16342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 383 IRDFKEMNERLTSEVESLKALNERLISE 466 I D K+M+E + S ESL +++ R+I+E Sbjct: 45 IEDVKDMDEYVLSYFESLNSMSRRIIAE 72 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRK-KAKMDEMESQIRDFKEMNERLTSEVESLKALNERLIS 463 EE +Q+ +LK + + +R + + +++ + + ++E NE+L +E+E L+ + L Sbjct: 101 EEVLQKVQLK--LKEENARVVELEGSLEQRKKEADGYRERNEKLAAEIEKLQQGKDHLTK 158 Query: 464 ENTALRE 484 E A E Sbjct: 159 ECEASSE 165 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,050,360 Number of Sequences: 59808 Number of extensions: 431245 Number of successful extensions: 1946 Number of sequences better than 10.0: 97 Number of HSP's better than 10.0 without gapping: 1635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1900 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -