BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G21 (862 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g32150.1 68414.m03955 bZIP transcription factor family protei... 54 9e-08 At2g35530.1 68415.m04352 bZIP transcription factor family protei... 54 2e-07 At5g60830.1 68418.m07631 bZIP transcription factor family protei... 52 7e-07 At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5... 51 9e-07 At2g04038.1 68415.m00382 bZIP transcription factor family protei... 50 2e-06 At5g15830.1 68418.m01852 bZIP transcription factor family protei... 50 3e-06 At5g38800.1 68418.m04691 bZIP transcription factor family protei... 49 3e-06 At1g13600.1 68414.m01595 bZIP transcription factor family protei... 48 1e-05 At3g30530.1 68416.m03864 bZIP transcription factor family protei... 47 1e-05 At1g68880.1 68414.m07883 bZIP transcription factor family protei... 47 1e-05 At4g34000.2 68417.m04825 ABA-responsive element-binding protein ... 44 2e-04 At3g17609.2 68416.m02248 bZIP transcription factor family protei... 43 2e-04 At3g17609.1 68416.m02247 bZIP transcription factor family protei... 43 2e-04 At4g34000.1 68417.m04824 ABA-responsive element-binding protein ... 42 5e-04 At3g56850.1 68416.m06322 ABA-responsive element-binding protein ... 42 5e-04 At5g44080.1 68418.m05393 bZIP transcription factor family protei... 40 0.002 At3g19290.1 68416.m02446 ABA-responsive element-binding protein ... 40 0.002 At2g41070.3 68415.m05073 basic leucine zipper transcription fact... 40 0.002 At2g41070.2 68415.m05072 basic leucine zipper transcription fact... 40 0.002 At2g41070.1 68415.m05071 basic leucine zipper transcription fact... 40 0.002 At2g36270.1 68415.m04452 bZIP transcription factor family protei... 40 0.002 At1g45249.2 68414.m05192 ABA-responsive element-binding protein ... 40 0.003 At1g03970.1 68414.m00383 G-box binding factor 4 (GBF4) identical... 40 0.003 At1g49720.1 68414.m05574 ABA-responsive element-binding protein ... 39 0.004 At3g44460.1 68416.m04779 basic leucine zipper transcription fact... 38 0.009 At2g40950.1 68415.m05056 bZIP transcription factor family protei... 38 0.009 At1g77920.1 68414.m09080 bZIP family transcription factor contai... 37 0.020 At5g42910.1 68418.m05231 basic leucine zipper transcription fact... 36 0.026 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 36 0.026 At5g10060.1 68418.m01165 expressed protein 36 0.046 At1g22070.1 68414.m02760 bZIP family transcription factor (TGA3)... 35 0.061 At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00... 35 0.061 At1g09720.1 68414.m01091 kinase interacting family protein simil... 35 0.061 At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing ... 35 0.080 At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing ... 35 0.080 At5g65210.2 68418.m08204 bZIP family transcription factor (TGA1)... 35 0.080 At5g65210.1 68418.m08203 bZIP family transcription factor (TGA1)... 35 0.080 At3g58840.1 68416.m06558 expressed protein 34 0.11 At3g56660.1 68416.m06301 bZIP transcription factor family protei... 34 0.11 At4g19600.1 68417.m02880 cyclin family protein similar to cyclin... 34 0.14 At2g21230.2 68415.m02521 bZIP family transcription factor contai... 33 0.18 At2g21230.1 68415.m02520 bZIP family transcription factor contai... 33 0.18 At1g42990.1 68414.m04949 bZIP transcription factor family protei... 33 0.18 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 33 0.18 At4g27595.1 68417.m03964 protein transport protein-related low s... 33 0.24 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 33 0.24 At3g12250.3 68416.m01530 bZIP family transcription factor contai... 33 0.32 At3g12250.2 68416.m01529 bZIP family transcription factor contai... 33 0.32 At3g12250.1 68416.m01528 bZIP family transcription factor contai... 33 0.32 At1g08320.1 68414.m00920 bZIP family transcription factor contai... 33 0.32 At1g06850.1 68414.m00730 bZIP transcription factor, putative con... 33 0.32 At3g28770.1 68416.m03591 expressed protein 32 0.43 At3g51960.2 68416.m05700 bZIP family transcription factor contai... 32 0.56 At3g51960.1 68416.m05699 bZIP family transcription factor contai... 32 0.56 At2g46680.1 68415.m05825 homeobox-leucine zipper protein 7 (HB-7... 32 0.56 At1g52150.2 68414.m05885 homeobox-leucine zipper family protein ... 32 0.56 At1g52150.1 68414.m05884 homeobox-leucine zipper family protein ... 32 0.56 At5g55820.1 68418.m06956 expressed protein 31 0.75 At5g10030.1 68418.m01162 bZIP family transcription factor (OBF4... 31 0.75 At2g31370.2 68415.m03834 bZIP transcription factor (POSF21) iden... 31 0.99 At2g31370.1 68415.m03833 bZIP transcription factor (POSF21) iden... 31 0.99 At4g17210.1 68417.m02588 myosin heavy chain-related contains wea... 31 1.3 At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain... 31 1.3 At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain... 31 1.3 At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain... 31 1.3 At1g43700.1 68414.m05020 VirE2-interacting protein (VIP1) identi... 31 1.3 At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 30 1.7 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 30 1.7 At4g04890.1 68417.m00712 homeobox-leucine zipper protein protode... 30 1.7 At4g01120.1 68417.m00150 G-box binding factor 2 (GBF2) identical... 30 1.7 At3g56870.1 68416.m06326 hypothetical protein 30 1.7 At3g50240.1 68416.m05494 kinesin motor protein-related KINESIN-L... 30 1.7 At3g22790.1 68416.m02873 kinase interacting family protein simil... 30 1.7 At2g40620.1 68415.m05010 bZIP transcription factor family protei... 30 1.7 At5g06960.2 68418.m00788 bZIP family transcription factor (OBF5)... 30 2.3 At5g06960.1 68418.m00787 bZIP family transcription factor (OBF5)... 30 2.3 At5g06950.2 68418.m00786 bZIP transcription factor HBP-1b homolo... 30 2.3 At5g06950.1 68418.m00785 bZIP transcription factor HBP-1b homolo... 30 2.3 At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-i... 30 2.3 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.0 At5g32482.1 68418.m03835 zinc knuckle (CCHC-type) family protein... 29 3.0 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 29 3.0 At1g56660.1 68414.m06516 expressed protein 29 3.0 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 29 4.0 At5g20490.1 68418.m02435 myosin, putative similar to myosin (GI:... 29 4.0 At1g68640.1 68414.m07843 bZIP family transcription factor (PERIA... 29 4.0 At5g46880.1 68418.m05777 homeobox-leucine zipper family protein ... 29 5.3 At5g06839.1 68418.m00773 bZIP family transcription factor contai... 29 5.3 At4g38900.1 68417.m05510 bZIP protein vsf-1 protein, Lycopersico... 29 5.3 At4g25070.1 68417.m03596 expressed protein ; expression supporte... 29 5.3 At2g11910.2 68415.m01278 expressed protein 29 5.3 At2g11910.1 68415.m01277 expressed protein 29 5.3 At1g73360.1 68414.m08491 homeobox-leucine zipper family protein ... 29 5.3 At1g07330.1 68414.m00781 hypothetical protein 29 5.3 At1g05230.2 68414.m00529 homeobox-leucine zipper family protein ... 29 5.3 At1g05230.1 68414.m00528 homeobox-leucine zipper family protein ... 29 5.3 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 28 7.0 At5g63550.1 68418.m07976 expressed protein 28 7.0 At5g44180.1 68418.m05406 homeobox transcription factor, putative... 28 7.0 At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc ... 28 7.0 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 28 7.0 At4g16570.1 68417.m02508 protein arginine N-methyltransferase-re... 28 7.0 At3g09670.1 68416.m01146 PWWP domain-containing protein 28 7.0 At2g30500.1 68415.m03715 kinase interacting family protein simil... 28 7.0 At1g04440.1 68414.m00435 casein kinase, putative similar to case... 28 7.0 At5g49470.2 68418.m06121 protein kinase family protein contains ... 28 9.2 At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family pr... 28 9.2 At5g20470.1 68418.m02433 myosin, putative similar to PIR|T00727 ... 28 9.2 At4g39690.1 68417.m05616 expressed protein 28 9.2 At3g44790.1 68416.m04823 meprin and TRAF homology domain-contain... 28 9.2 At3g43530.1 68416.m04621 hypothetical protein contains Pfam prof... 28 9.2 At3g05130.1 68416.m00557 expressed protein ; expression supporte... 28 9.2 At2g31600.2 68415.m03861 expressed protein 28 9.2 At2g31600.1 68415.m03860 expressed protein 28 9.2 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 28 9.2 >At1g32150.1 68414.m03955 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 389 Score = 54.4 bits (125), Expect = 9e-08 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 2/88 (2%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 E K QR+K NR +A+ SR RK+A+ DE+ + N L +E+ LK+ E L++E Sbjct: 295 EIKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNGENSSLRAEINKLKSQYEELLAE 354 Query: 467 NTALR-EAAAAQSVPGGQ-GPAESTPQQ 544 N++L+ + ++A S+ GG E PQ+ Sbjct: 355 NSSLKNKFSSAPSLEGGDLDKNEQEPQR 382 >At2g35530.1 68415.m04352 bZIP transcription factor family protein contains Pfam domain PF00170: bZIP transcription factor; similar to G-Box binding protein 2 (GI:5381313) [Catharanthus roseus]. Length = 409 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 E K QR+K NR +A+ SR RK+A+ DE+ + E N L +E+ LK+ E L +E Sbjct: 305 ELKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNEENTNLRAEINKLKSQCEELTTE 364 Query: 467 NTALRE 484 NT+L++ Sbjct: 365 NTSLKD 370 >At5g60830.1 68418.m07631 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 206 Score = 51.6 bits (118), Expect = 7e-07 Identities = 22/70 (31%), Positives = 44/70 (62%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 EE+ R+ + NR +A+ SR RKK +++E++ Q+ +N L+ +V +L N +++ E Sbjct: 69 EERRARRMVSNRESARRSRMRKKKQIEELQQQVEQLMMLNHHLSEKVINLLESNHQILQE 128 Query: 467 NTALREAAAA 496 N+ L+E ++ Sbjct: 129 NSQLKEKVSS 138 >At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5 protein GI:2251085 from [Arabidopsis thaliana] Length = 168 Score = 51.2 bits (117), Expect = 9e-07 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 2/74 (2%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 RKR E K ++ L+NRV+AQ +R+RKKA + E+E++++D + N L + +L Sbjct: 78 RKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTL 137 Query: 437 KALNERL--ISENT 472 + N+ L I +NT Sbjct: 138 QNENQMLRHILKNT 151 >At2g04038.1 68415.m00382 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 166 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/101 (27%), Positives = 51/101 (50%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE 370 NNY D+++ S S + + +E+ QR+ L NR +A+ SR RK+ +DE Sbjct: 41 NNYSSSSNSQDLMISNNSTSDEDHHQ-SIMVLDERKQRRMLSNRESARRSRMRKQRHLDE 99 Query: 371 MESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAA 493 + SQ+ + N L ++ + ++ EN+ L+E A+ Sbjct: 100 LWSQVIRLRNENNCLIDKLNRVSETQNCVLKENSKLKEEAS 140 >At5g15830.1 68418.m01852 bZIP transcription factor family protein similar to common plant regulatory factor 7 GI:9650828 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 186 Score = 49.6 bits (113), Expect = 3e-06 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 5/103 (4%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWE-----EKMQRKKLKNRVAAQTSRDRKK 355 NN + + L++ SP + D T E E+ QR+ + NR +A+ SR RK+ Sbjct: 35 NNLNILQYPQIQELNLQSPVSNNSTTSDDATEEIFVINERKQRRMVSNRESARRSRMRKQ 94 Query: 356 AKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 +DE+ SQ+ + N +L ++ + N+ +I EN++L+E Sbjct: 95 RHLDELLSQVAWLRSENHQLLDKLNQVSDNNDLVIQENSSLKE 137 >At5g38800.1 68418.m04691 bZIP transcription factor family protein similar to bZIP transcription factor GI:1769891 from [Arabidopsis thaliana]; contains PFAM profile: bZIP transcription factor PF00170 Length = 165 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/65 (33%), Positives = 42/65 (64%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 E+ Q++K+ NR +A+ SR RK+ ++DE+ SQ+ ++ N +L ++ + E++I EN Sbjct: 71 ERKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLNCVLESQEKVIEEN 130 Query: 470 TALRE 484 L+E Sbjct: 131 VQLKE 135 >At1g13600.1 68414.m01595 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 196 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/98 (27%), Positives = 50/98 (51%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE 370 NNY D++ ++ S S + + +E+ QR+ + NR +A+ SR RK+ +DE Sbjct: 54 NNYSSSSNGQDLM--TSNNSTSDEDHQQSMVIDERKQRRMISNRESARRSRMRKQRHLDE 111 Query: 371 MESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 + SQ+ + N L ++ + +E + EN L+E Sbjct: 112 LWSQVIRLRTDNHCLMDKLNRVSESHELALKENAKLKE 149 >At3g30530.1 68416.m03864 bZIP transcription factor family protein similar to bZIP protein(G/HBF-1) GI:1905785 from [Glycine max ]; contains PFAM profile: bZIP transcription factor PF00170 Length = 173 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/65 (32%), Positives = 41/65 (63%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 E+ QR+ + NR +A+ SR RK+ +DE+ SQ+ + N +L ++ +L +++++ EN Sbjct: 80 ERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVLQEN 139 Query: 470 TALRE 484 L+E Sbjct: 140 AQLKE 144 >At1g68880.1 68414.m07883 bZIP transcription factor family protein similar to common plant regulatory factor 6 GI:9650826 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 138 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/65 (35%), Positives = 38/65 (58%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 E+ +R+K+ NR +A+ SR RK+ M+E+ S + N+ L E+ + E++I EN Sbjct: 46 ERKRRRKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDELSQARECYEKVIEEN 105 Query: 470 TALRE 484 LRE Sbjct: 106 MKLRE 110 >At4g34000.2 68417.m04825 ABA-responsive element-binding protein / abscisic acid responsive elements-binding factor (ABRE) / ABA-responsive elements-binding factor (ABF3) identical to abscisic acid responsive elements-binding factor (ABF3) GI:6739280 from [Arabidopsis thaliana]; identical to cDNA abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds GI:6739279 Length = 454 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL-TSEVESLKALNERLI 460 E+ Q++ +KNR +A SR RK+A E+E++I KE+NE L +VE ++ +L+ Sbjct: 373 ERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIMEKQKNQLL 430 >At3g17609.2 68416.m02248 bZIP transcription factor family protein / HY5-like protein (HYH) nearly identical to HY5-like protein [Arabidopsis thaliana] GI:18042111; similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor Length = 149 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/67 (29%), Positives = 41/67 (61%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 R+R + + E + ++ L+NRV+AQ +R+RKK + ++ES+ + + N++L ++ +L Sbjct: 68 RRRGRNPVDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTL 127 Query: 437 KALNERL 457 N L Sbjct: 128 TNENTML 134 >At3g17609.1 68416.m02247 bZIP transcription factor family protein / HY5-like protein (HYH) nearly identical to HY5-like protein [Arabidopsis thaliana] GI:18042111; similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor Length = 135 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/67 (29%), Positives = 41/67 (61%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESL 436 R+R + + E + ++ L+NRV+AQ +R+RKK + ++ES+ + + N++L ++ +L Sbjct: 54 RRRGRNPVDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTL 113 Query: 437 KALNERL 457 N L Sbjct: 114 TNENTML 120 >At4g34000.1 68417.m04824 ABA-responsive element-binding protein / abscisic acid responsive elements-binding factor (ABRE) / ABA-responsive elements-binding factor (ABF3) identical to abscisic acid responsive elements-binding factor (ABF3) GI:6739280 from [Arabidopsis thaliana]; identical to cDNA abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds GI:6739279 Length = 449 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/42 (45%), Positives = 29/42 (69%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 E+ Q++ +KNR +A SR RK+A E+E++I KE+NE L Sbjct: 373 ERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEEL 414 >At3g56850.1 68416.m06322 ABA-responsive element-binding protein 3 (AREB3) identical to ABA-responsive element binding protein 3 (AREB3) [Arabidopsis thaliana] GI:9967421 Length = 297 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 3/69 (4%) Frame = +2 Query: 248 SPSRKRRLDHLTWE---EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLT 418 +P RKR E E+ Q++ +KNR +A SR RK+A E+E ++ +E NERL Sbjct: 209 TPGRKRVASGEVVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLR 268 Query: 419 SEVESLKAL 445 + E K L Sbjct: 269 KQKEVEKIL 277 >At5g44080.1 68418.m05393 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 315 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/44 (43%), Positives = 29/44 (65%) Frame = +2 Query: 299 QRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVE 430 QR+ +KNR +A SR+RK+A E+E+ +E NE L+ E+E Sbjct: 235 QRRMIKNRESAARSRERKQAYQVELEALAAKLEEENELLSKEIE 278 >At3g19290.1 68416.m02446 ABA-responsive element-binding protein 2 (AREB2) almost identical (one amino acid) to GB:AAF27182 from (Arabidopsis thaliana); contains Pfam profile PF00170:bZIP transcription factor; identical to cDNA abscisic acid responsive elements-binding factor (ABRE) mRNA, partial cds GI:6739282 Length = 431 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 E+ QR+ +KNR +A SR RK+A E+E++I K+ N+ L + + + + + E Sbjct: 352 ERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKNELKET 411 Query: 470 T 472 + Sbjct: 412 S 412 >At2g41070.3 68415.m05073 basic leucine zipper transcription factor (BZIP12) nearly identical to basic leucine zipper transcription factor [Arabidopsis thaliana] GI:21694632; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 4/67 (5%) Frame = +2 Query: 248 SPSRKRRLDHLTWE--EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL-- 415 +P RKR + + E+ Q++ +KNR +A SR RK+A E+E ++ +E NE+L Sbjct: 175 APGRKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRR 234 Query: 416 TSEVESL 436 EVE + Sbjct: 235 LKEVEKI 241 >At2g41070.2 68415.m05072 basic leucine zipper transcription factor (BZIP12) nearly identical to basic leucine zipper transcription factor [Arabidopsis thaliana] GI:21694632; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 4/67 (5%) Frame = +2 Query: 248 SPSRKRRLDHLTWE--EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL-- 415 +P RKR + + E+ Q++ +KNR +A SR RK+A E+E ++ +E NE+L Sbjct: 175 APGRKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRR 234 Query: 416 TSEVESL 436 EVE + Sbjct: 235 LKEVEKI 241 >At2g41070.1 68415.m05071 basic leucine zipper transcription factor (BZIP12) nearly identical to basic leucine zipper transcription factor [Arabidopsis thaliana] GI:21694632; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 4/67 (5%) Frame = +2 Query: 248 SPSRKRRLDHLTWE--EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL-- 415 +P RKR + + E+ Q++ +KNR +A SR RK+A E+E ++ +E NE+L Sbjct: 175 APGRKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRR 234 Query: 416 TSEVESL 436 EVE + Sbjct: 235 LKEVEKI 241 >At2g36270.1 68415.m04452 bZIP transcription factor family protein / ABA-responsive element-binding protein, putative similar to ABA-responsive element binding protein 1 (AREB1) GI:9967417 from [Arabidopsis thaliana]; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 442 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/64 (32%), Positives = 36/64 (56%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 E+ QR+ +KNR +A SR RK+A E+E+++ KE N +L + L+ ++ E+ Sbjct: 356 ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFES 415 Query: 470 TALR 481 R Sbjct: 416 LKSR 419 >At1g45249.2 68414.m05192 ABA-responsive element-binding protein 1 (AREB1) identical to ABA-responsive element binding protein 1 (AREB1) [Arabidopsis thaliana] GI:9967417 Length = 416 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 28/42 (66%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 E+ QR+ +KNR +A SR RK+A E+E+++ KE N+ L Sbjct: 337 ERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDEL 378 >At1g03970.1 68414.m00383 G-box binding factor 4 (GBF4) identical to G-box binding factor 4 (GBF4) SP:P42777 from [Arabidopsis thaliana] Length = 270 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +2 Query: 299 QRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVE 430 Q++ +KNR +A SR+RK+A E+E+ +E NE+L E+E Sbjct: 191 QKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIE 234 >At1g49720.1 68414.m05574 ABA-responsive element-binding protein / abscisic acid responsive elements-binding factor (ABRE) identical to abscisic acid responsive elements-binding factor GB:AAF27179 GI:6739274 from [Arabidopsis thaliana]; identical to cDNA abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds GI:6739273 Length = 392 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL-TSEVESLKALNERL 457 E+ Q++ +KNR +A SR RK+A E+E++I K +N+ L + E +K N L Sbjct: 312 ERRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDLQKKQAEIMKTHNSEL 368 >At3g44460.1 68416.m04779 basic leucine zipper transcription factor (BZIP67) identical to basic leucine zipper transcription factor GI:18656053 from [Arabidopsis thaliana]; identical to cDNA basic leucine zipper transcription factor (atbzip67 gene) GI:18656052 Length = 331 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEV-ESLKALNERLISE 466 E+ QR+ +KNR +A SR R++A E+E ++ + E N +L V E+ K + +IS Sbjct: 248 ERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKEIVEENEKKRRQEIISR 307 Query: 467 N 469 + Sbjct: 308 S 308 >At2g40950.1 68415.m05056 bZIP transcription factor family protein similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 +EK + + ++NR +AQ SR RKK ++E+E ++R+ L ++ A N L Sbjct: 228 DEKKRARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATL 284 >At1g77920.1 68414.m09080 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 368 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/75 (29%), Positives = 38/75 (50%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE 370 NN + + S ++ PS S + D +KM+R+ +NR AA+ SR RKKA + + Sbjct: 60 NNIKINYDSSHNQIEAEQPS-SNDNQDDDGRIHDKMKRRLAQNREAARKSRLRKKAYVQQ 118 Query: 371 MESQIRDFKEMNERL 415 +E ++ + L Sbjct: 119 LEESRLKLSQLEQEL 133 >At5g42910.1 68418.m05231 basic leucine zipper transcription factor (BZIP15) identical to cDNA basic leucine zipper transcription factor (atbzip15 gene) GI:18656050, basic leucine zipper transcription factor [Arabidopsis thaliana] GI:18656051; contains Pfam profile PF00170: bZIP transcription factor Length = 370 Score = 36.3 bits (80), Expect = 0.026 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 +K R+K+KNR +A SR RK+A+ E+E ++ + K+ E L + L+ Sbjct: 294 DKKLRRKIKNRESAARSRARKQAQTMEVEVELENLKKDYEELLKQHVELR 343 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 36.3 bits (80), Expect = 0.026 Identities = 25/78 (32%), Positives = 40/78 (51%) Frame = +2 Query: 305 KKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 ++++NR +AQ SR RKK + +E+E R K MN + + L +++EN ALR+ Sbjct: 196 RQIRNRESAQLSRLRKKQQTEELE---RKVKSMN----ATIAELNGKIAYVMAENVALRQ 248 Query: 485 AAAAQSVPGGQGPAESTP 538 A S P + P Sbjct: 249 QMAVASGAPPMNPYMAAP 266 >At5g10060.1 68418.m01165 expressed protein Length = 469 Score = 35.5 bits (78), Expect = 0.046 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 4/103 (3%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSR----DRKKAKMDEME 376 E+D + A +P RK L EE + R+ ++ + Q SR ++ K + E E Sbjct: 204 EKDVEEACSTAKDNPKRKSLAKELEEEEYLLRQCIEKLKSVQGSRSSLVNQLKDALREQE 263 Query: 377 SQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSV 505 S++ + K + + E + + +RL E+ ++ AA ++ Sbjct: 264 SELDNLKAQIQVAKEQTEEAQNMQKRLNDEDYTSKQTTAATTI 306 >At1g22070.1 68414.m02760 bZIP family transcription factor (TGA3) identical to transcription factor GI:304113 from [Arabidopsis thaliana] Length = 384 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +2 Query: 239 ASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 A PS + + D + +KM+R+ +NR AA+ SR RKKA + ++E ++ + L Sbjct: 82 AEPSSNNDQDEDRIN--DKMKRRLAQNREAARKSRLRKKAHVQQLEESRLKLSQLEQEL 138 >At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 592 Score = 35.1 bits (77), Expect = 0.061 Identities = 24/83 (28%), Positives = 42/83 (50%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 VK + + V S K +++ LT E+ RK+L VAAQ +++ + ++ E + Sbjct: 87 VKRVEEAIRKKVEESLQSEKIKMEILTLLEE-GRKRLNEEVAAQLEEEKEASLIEAKEKE 145 Query: 383 IRDFKEMNERLTSEVESLKALNE 451 R+ +E ER E+LK + E Sbjct: 146 EREQQEKEERERIAEENLKRVEE 168 >At1g09720.1 68414.m01091 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 928 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +2 Query: 281 TWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVE 430 T E +R+ + + A DR+K +DE S +RD++E+ +L SEVE Sbjct: 521 TEAEDEERRNWRQLLPADGMEDREKVLLDEYSSVLRDYREVKRKL-SEVE 569 >At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 765 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQ--RKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEM 403 L+V S + + + WEE ++ + + R A T+++ + + + +E ++ + K Sbjct: 514 LEVKLDSTVARNQAEKQAWEEDLRVLEETWRRRCEALTAQN-EASPAEGIEKELENAKLR 572 Query: 404 NERLTSEVESLKALNERLISE 466 N+R+ E ES++ L +RLI E Sbjct: 573 NKRMKEEHESVRELADRLIEE 593 >At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 788 Score = 34.7 bits (76), Expect = 0.080 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Frame = +2 Query: 230 LDVASPSPSRKRRLDHLTWEEKMQ--RKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEM 403 L+V S + + + WEE ++ + + R A T+++ + + + +E ++ + K Sbjct: 514 LEVKLDSTVARNQAEKQAWEEDLRVLEETWRRRCEALTAQN-EASPAEGIEKELENAKLR 572 Query: 404 NERLTSEVESLKALNERLISE 466 N+R+ E ES++ L +RLI E Sbjct: 573 NKRMKEEHESVRELADRLIEE 593 >At5g65210.2 68418.m08204 bZIP family transcription factor (TGA1) identical to transcription factor (TGA1) GI:16550 from [Arabidopsis thaliana] Length = 368 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +2 Query: 161 MSAPIIITVPNNYLVKEEDSDMILDVASPSPSR-KRRLDHLTWEEKMQRKKLKNRVAAQT 337 M+ P I +PNN + S+ + +P + +K+QR+ +NR AA+ Sbjct: 39 MNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARK 98 Query: 338 SRDRKKAKMDEMESQIRDFKEMNERL 415 SR RKKA + ++E+ ++ + L Sbjct: 99 SRLRKKAYVQQLETSRLKLIQLEQEL 124 >At5g65210.1 68418.m08203 bZIP family transcription factor (TGA1) identical to transcription factor (TGA1) GI:16550 from [Arabidopsis thaliana] Length = 368 Score = 34.7 bits (76), Expect = 0.080 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +2 Query: 161 MSAPIIITVPNNYLVKEEDSDMILDVASPSPSR-KRRLDHLTWEEKMQRKKLKNRVAAQT 337 M+ P I +PNN + S+ + +P + +K+QR+ +NR AA+ Sbjct: 39 MNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARK 98 Query: 338 SRDRKKAKMDEMESQIRDFKEMNERL 415 SR RKKA + ++E+ ++ + L Sbjct: 99 SRLRKKAYVQQLETSRLKLIQLEQEL 124 >At3g58840.1 68416.m06558 expressed protein Length = 318 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = +2 Query: 344 DRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGP 523 D+ K E+E +I D + N+ LT E LK ERL E +++ A + G+ Sbjct: 16 DQGGVKTTELERKIEDMENKNQELTRENRELKERLERLTGEIEEMKDVEAEMNQRFGEME 75 Query: 524 AESTPQQKE 550 E ++E Sbjct: 76 KEIEEYEEE 84 >At3g56660.1 68416.m06301 bZIP transcription factor family protein similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 620 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 E+K + ++NR +A SR RKK ++E+E ++++ L+S++ A N L Sbjct: 172 EKKKNVRLVRNRESAHLSRQRKKHYVEELEDKVKNMHSTISELSSKMSYFVAENVTL 228 >At4g19600.1 68417.m02880 cyclin family protein similar to cyclin T2a [Homo sapiens] GI:2981198; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 541 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLD 274 NN +V E+ +MI DV+S PSRKR+++ Sbjct: 467 NNLVVNTEEGEMIDDVSSTMPSRKRKME 494 >At2g21230.2 68415.m02521 bZIP family transcription factor contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 460 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/65 (26%), Positives = 38/65 (58%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + K ++ L NRV+A S++RK M E+E +++ + L++++ L+ + L ++ Sbjct: 370 DPKRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQ 429 Query: 467 NTALR 481 N+ L+ Sbjct: 430 NSELK 434 >At2g21230.1 68415.m02520 bZIP family transcription factor contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 519 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/65 (26%), Positives = 38/65 (58%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + K ++ L NRV+A S++RK M E+E +++ + L++++ L+ + L ++ Sbjct: 370 DPKRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQ 429 Query: 467 NTALR 481 N+ L+ Sbjct: 430 NSELK 434 >At1g42990.1 68414.m04949 bZIP transcription factor family protein contains Pfam profile: PF00170: bZIP transcription factor Length = 295 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/55 (32%), Positives = 32/55 (58%) Frame = +2 Query: 293 KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 K +R++++NR AA SR+RKK + ++E + + + RL +E A N+ L Sbjct: 142 KKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECLRLGRMLECFVAENQSL 196 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 33.5 bits (73), Expect = 0.18 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +1 Query: 301 KKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFERE 453 ++E EK RGS ++ S++ N ESD +R+ K GGE + ERE Sbjct: 184 RREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKERE 234 >At4g27595.1 68417.m03964 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1212 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +2 Query: 305 KKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 KK++ AA+ S K+ K+ + + + ++E L A+NERL+ + T L+ Sbjct: 682 KKIEELSAAKESLVEKETKLLSTVQEAEELRRRELACLKKIEELSAVNERLVDKETKLQS 741 Query: 485 A 487 + Sbjct: 742 S 742 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 33.1 bits (72), Expect = 0.24 Identities = 22/72 (30%), Positives = 35/72 (48%) Frame = +2 Query: 278 LTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERL 457 +T +E+M ++ K+ + R+ E++SQI + E L+ EVE+LK ER Sbjct: 495 MTKKEEMIEEECKSLEIKKEEREEYLRLQSELKSQIEKSRVHEEFLSKEVENLKQEKERF 554 Query: 458 ISENTALREAAA 493 E L E A Sbjct: 555 EKEWEILDEKQA 566 >At3g12250.3 68416.m01530 bZIP family transcription factor contains Pfam profile:PF00170 bZIP transcription factor Length = 324 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +2 Query: 239 ASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 A+ S S R D L ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 24 AAASDSSDRSKDKL--DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 80 >At3g12250.2 68416.m01529 bZIP family transcription factor contains Pfam profile:PF00170 bZIP transcription factor Length = 330 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +2 Query: 239 ASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 A+ S S R D L ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 30 AAASDSSDRSKDKL--DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At3g12250.1 68416.m01528 bZIP family transcription factor contains Pfam profile:PF00170 bZIP transcription factor Length = 330 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +2 Query: 239 ASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 A+ S S R D L ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 30 AAASDSSDRSKDKL--DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At1g08320.1 68414.m00920 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 481 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +2 Query: 236 VASPSPSRKRRLDHLTWEE---KMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMN 406 +A P PS +R + ++ K R+ +NR AA+ SR RKKA + ++ES ++ Sbjct: 156 LAPPKPSEDKRKATTSGKQLDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLSQLE 215 Query: 407 ERL 415 + L Sbjct: 216 QEL 218 >At1g06850.1 68414.m00730 bZIP transcription factor, putative contains Pfam profile: PF00170 bZIP transcription factor Length = 337 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 2/87 (2%) Frame = +2 Query: 227 ILDVASPSPSRKRRLDHLTW--EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKE 400 I+D P K L L W + K ++ L NR +A S++RK + E+E +++ + Sbjct: 129 IMDAKKAMPPEK--LSEL-WNIDPKRAKRILANRQSAARSKERKARYIQELERKVQSLQT 185 Query: 401 MNERLTSEVESLKALNERLISENTALR 481 L++++ + L +ENT L+ Sbjct: 186 EATTLSAQLTLYQRDTNGLANENTELK 212 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 32.3 bits (70), Expect = 0.43 Identities = 25/96 (26%), Positives = 46/96 (47%) Frame = +2 Query: 182 TVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAK 361 T N +KEE+ D S + K R + +EEK + K + + + S+D+K+ + Sbjct: 982 TKSENSKLKEENKDNKEKKESEDSASKNR-EKKEYEEKKSKTKEEAKKEKKKSQDKKREE 1040 Query: 362 MDEMESQIRDFKEMNERLTSEVESLKALNERLISEN 469 D E + + KE + L ++ + + E+ SEN Sbjct: 1041 KDSEERKSKKEKEESRDLKAKKKE-EETKEKKESEN 1075 Score = 28.3 bits (60), Expect = 7.0 Identities = 24/116 (20%), Positives = 46/116 (39%) Frame = +2 Query: 182 TVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAK 361 T NN KE+ + + S K ++ M+ KKL+N+ + S+D K Sbjct: 668 TNDNNMESKEDTKSEVEVKKNDGSSEKGEEGKENNKDSMEDKKLENKESQTDSKDDKSVD 727 Query: 362 MDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGPAE 529 + E+QI + +++ K E ++ R ++V G + +E Sbjct: 728 DKQEEAQIYGGESKDDKSVEAKGKKKESKENKKTKTNENRVRNKEENVQGNKKESE 783 >At3g51960.2 68416.m05700 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 228 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 290 EKMQRKKL-KNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + +K+L NR A + R++KKA+ +E ++ + +NE+ +++S + + LI Sbjct: 95 DSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVETELIRL 154 Query: 467 NTALRE 484 L E Sbjct: 155 RALLVE 160 >At3g51960.1 68416.m05699 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 227 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 290 EKMQRKKL-KNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + +K+L NR A + R++KKA+ +E ++ + +NE+ +++S + + LI Sbjct: 94 DSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVETELIRL 153 Query: 467 NTALRE 484 L E Sbjct: 154 RALLVE 159 >At2g46680.1 68415.m05825 homeobox-leucine zipper protein 7 (HB-7) / HD-ZIP transcription factor 7 identical to homeobox-leucine zipper protein ATHB-7 (HD-ZIP protein ATHB-7) (SP:P46897) [Arabidopsis thaliana]; Length = 258 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +2 Query: 320 RVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREA 487 +VA R + K ++E++ ++ + L S+ ESLK + L+SE L+EA Sbjct: 72 QVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSELQRLKEA 127 >At1g52150.2 68414.m05885 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to to HD-zip transcription factor (athb-8) (GI:7270235) [Arabidopsis thaliana]; contains Pfam profiles PF01852: START domain, PF00046: Homeobox domain Length = 837 Score = 31.9 bits (69), Expect = 0.56 Identities = 22/101 (21%), Positives = 46/101 (45%), Gaps = 1/101 (0%) Frame = +2 Query: 233 DVASPSPSRKRRL-DHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNE 409 D PS R+++L ++ K++K + R++++ + +++ R MN+ Sbjct: 35 DCPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNK 94 Query: 410 RLTSEVESLKALNERLISENTALREAAAAQSVPGGQGPAES 532 L E + L+ +L+ EN+ R+ S+P ES Sbjct: 95 LLMEENDRLQKQVSQLVHENSYFRQHTPNPSLPAKDTSCES 135 >At1g52150.1 68414.m05884 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to to HD-zip transcription factor (athb-8) (GI:7270235) [Arabidopsis thaliana]; contains Pfam profiles PF01852: START domain, PF00046: Homeobox domain Length = 836 Score = 31.9 bits (69), Expect = 0.56 Identities = 22/101 (21%), Positives = 46/101 (45%), Gaps = 1/101 (0%) Frame = +2 Query: 233 DVASPSPSRKRRL-DHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNE 409 D PS R+++L ++ K++K + R++++ + +++ R MN+ Sbjct: 35 DCPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNK 94 Query: 410 RLTSEVESLKALNERLISENTALREAAAAQSVPGGQGPAES 532 L E + L+ +L+ EN+ R+ S+P ES Sbjct: 95 LLMEENDRLQKQVSQLVHENSYFRQHTPNPSLPAKDTSCES 135 >At5g55820.1 68418.m06956 expressed protein Length = 1826 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/82 (20%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKL-KNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVES 433 RK++ + W+++M++KK + R + +K + +E + ++++ K+ +R+ Sbjct: 1572 RKKKEAEMAWKQEMEKKKKEEERKRKEFEMADRKRQREEEDKRLKEAKK-RQRIADFQRQ 1630 Query: 434 LKALNERLISENTALREAAAAQ 499 + +E+L +E R+A A+ Sbjct: 1631 QREADEKLQAEKELKRQAMDAR 1652 >At5g10030.1 68418.m01162 bZIP family transcription factor (OBF4) identical to ocs-element binding factor 4 GI:414613 from [Arabidopsis thaliana] Length = 364 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMES 379 +K+QR+ +NR AA+ SR RKKA + ++E+ Sbjct: 79 DKIQRRLAQNREAARKSRLRKKAYVQQLET 108 >At2g31370.2 68415.m03834 bZIP transcription factor (POSF21) identical to GB:Q04088 Length = 398 Score = 31.1 bits (67), Expect = 0.99 Identities = 22/97 (22%), Positives = 45/97 (46%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE 370 N L+ + D +D A S S + + + K ++ NR +A S++RK + E Sbjct: 170 NEMLMSGNEDDSAID-AKKSMSATKLAELALIDPKRAKRIWANRQSAARSKERKTRYIFE 228 Query: 371 MESQIRDFKEMNERLTSEVESLKALNERLISENTALR 481 +E +++ + L++++ L+ L EN L+ Sbjct: 229 LERKVQTLQTEATTLSAQLTLLQRDTNGLTVENNELK 265 >At2g31370.1 68415.m03833 bZIP transcription factor (POSF21) identical to GB:Q04088 Length = 398 Score = 31.1 bits (67), Expect = 0.99 Identities = 22/97 (22%), Positives = 45/97 (46%) Frame = +2 Query: 191 NNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDE 370 N L+ + D +D A S S + + + K ++ NR +A S++RK + E Sbjct: 170 NEMLMSGNEDDSAID-AKKSMSATKLAELALIDPKRAKRIWANRQSAARSKERKTRYIFE 228 Query: 371 MESQIRDFKEMNERLTSEVESLKALNERLISENTALR 481 +E +++ + L++++ L+ L EN L+ Sbjct: 229 LERKVQTLQTEATTLSAQLTLLQRDTNGLTVENNELK 265 >At4g17210.1 68417.m02588 myosin heavy chain-related contains weak similarity to Swiss-Prot:P14105 myosin heavy chain, nonmuscle (Cellular myosin heavy chain) (NMMHC) [Gallus gallus] Length = 527 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/81 (24%), Positives = 39/81 (48%) Frame = +2 Query: 275 HLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNER 454 +L+ EE++ +L+ A+ + K+ +M I + ++ ERL S+ K E+ Sbjct: 178 NLSVEERLA--ELQRAEEAECASMVNSNKIKDMSHDIAEMRDAAERLNSDAARKKEEEEQ 235 Query: 455 LISENTALREAAAAQSVPGGQ 517 + E+ ALRE + + Q Sbjct: 236 IKEESIALRETYVCKKLEAKQ 256 >At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +1 Query: 301 KKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFEREVD*REHSAT 480 + + SR SR E + GR+G D ++ + G S ERE + HS++ Sbjct: 200 RDDDRNSRDGDRHSRDSEDRYGRDGNRDDDYRGRSRSVDNYGSRGRSSEREREDDGHSSS 259 Query: 481 RSGG 492 R G Sbjct: 260 RGSG 263 >At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +1 Query: 301 KKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFEREVD*REHSAT 480 + + SR SR E + GR+G D ++ + G S ERE + HS++ Sbjct: 200 RDDDRNSRDGDRHSRDSEDRYGRDGNRDDDYRGRSRSVDNYGSRGRSSEREREDDGHSSS 259 Query: 481 RSGG 492 R G Sbjct: 260 RGSG 263 >At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +1 Query: 301 KKETEKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFEREVD*REHSAT 480 + + SR SR E + GR+G D ++ + G S ERE + HS++ Sbjct: 200 RDDDRNSRDGDRHSRDSEDRYGRDGNRDDDYRGRSRSVDNYGSRGRSSEREREDDGHSSS 259 Query: 481 RSGG 492 R G Sbjct: 260 RGSG 263 >At1g43700.1 68414.m05020 VirE2-interacting protein (VIP1) identical to VirE2-interacting protein VIP1 GB:AAF37279 GI:7258340 from [Arabidopsis thaliana] Length = 341 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + K ++ L NR +A S++RK E+E +++ + L+++V L+ L +E Sbjct: 194 DPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTE 253 Query: 467 NTALR 481 N L+ Sbjct: 254 NKHLK 258 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/64 (20%), Positives = 34/64 (53%) Frame = +2 Query: 263 RRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKA 442 + L HL W+EK + ++ VA T ++ + +E+ ++D + + E++ ++ Sbjct: 253 KELSHLKWQEKATKMAYEDTVAKIT---EQRDSLQNLENSLKDERVKMDESNEELKKFES 309 Query: 443 LNER 454 ++E+ Sbjct: 310 VHEK 313 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/90 (23%), Positives = 46/90 (51%), Gaps = 2/90 (2%) Frame = +2 Query: 203 VKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 V++ +++ L A ++R++ + + +R+ ++ R A+ ++RK + E+E Q Sbjct: 655 VEKAENEKRLKAALEQEEKERKIKEAREKAENERRAVEAREKAE--QERKMKEQQELELQ 712 Query: 383 IRDF--KEMNERLTSEVESLKALNERLISE 466 +++ KE R E +L+ ER I E Sbjct: 713 LKEAFEKEEENRRMREAFALEQEKERRIKE 742 >At4g04890.1 68417.m00712 homeobox-leucine zipper protein protodermal factor 2 (PDF2) identical to GP|14276060| protodermal factor2 (GI:14276060) Length = 743 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 8/114 (7%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMD-EMESQI 385 E S L S P++K+R T + + + + RK+ D +E Sbjct: 46 ENPSGEELQDPSQRPNKKKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRDLNLEPLQ 105 Query: 386 RDFKEMNERLTSEVES-------LKALNERLISENTALREAAAAQSVPGGQGPA 526 F N+R + +S LK+ N++L +EN +EA + + P GPA Sbjct: 106 VKFWFQNKRTQMKAQSERHENQILKSDNDKLRAENNRYKEALSNATCPNCGGPA 159 >At4g01120.1 68417.m00150 G-box binding factor 2 (GBF2) identical to G-box binding factor 2 (GBF2) SP:P42775 from [Arabidopsis thaliana];contains Pfam profile: PF00170 bZIP transcription factor Length = 360 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 7/67 (10%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKA-------KMDEMESQIRDFKEMNERLTSEVESLKAL 445 E K +++K NR +A+ SR RK+A K+D + ++ + +L +E E L+ Sbjct: 249 EVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLE 308 Query: 446 NERLISE 466 NE ++ + Sbjct: 309 NEAILDQ 315 >At3g56870.1 68416.m06326 hypothetical protein Length = 670 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +2 Query: 374 ESQIRDFKEMNERLTSEVESLKALNERLI--SENTALREAAAAQSVPGGQGPAESTPQ 541 + Q+RDF+ + RLT E++S++ + +R + NT+ V G AE T + Sbjct: 540 QGQMRDFQNVAARLTKELKSMRQITKRCLQAESNTSNMSDCNLDEVKTVIGNAEKTEE 597 >At3g50240.1 68416.m05494 kinesin motor protein-related KINESIN-LIKE PROTEIN KIF4, Homo sapiens, EMBL:AF179308 Length = 1051 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 290 EKMQRKKLKNRVAA---QTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNER 454 ++++ K+ + RV +T R + KM E+E + R ++ + L +EVE L A ++R Sbjct: 520 KRLEEKESEMRVCGIGTETIRQHFEKKMMELEKEKRTVQDERDMLLAEVEELAASSDR 577 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +2 Query: 254 SRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 +R + + EEK +R KL+ R ++ S+DRK + E+E Q Sbjct: 1375 TRIKTIKQAVAEEKKRRGKLRRRSSSHRSKDRKLFEEIELEDQ 1417 >At2g40620.1 68415.m05010 bZIP transcription factor family protein identical to b-Zip DNA binding protein GI:2246376 from [Arabidopsis thaliana]; contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 367 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/65 (24%), Positives = 35/65 (53%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + K ++ + NR +A S++RK + E+E +++ + L++++ + L SE Sbjct: 148 DPKRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 207 Query: 467 NTALR 481 NT L+ Sbjct: 208 NTELK 212 >At5g06960.2 68418.m00788 bZIP family transcription factor (OBF5) identical to bZIP family transcription factor (OBF5) GI:414615 from [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 44 DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At5g06960.1 68418.m00787 bZIP family transcription factor (OBF5) identical to bZIP family transcription factor (OBF5) GI:414615 from [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 44 DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At5g06950.2 68418.m00786 bZIP transcription factor HBP-1b homolog identical to transcription factor HBP-1b homolog SP:P43273 from [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 44 DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At5g06950.1 68418.m00785 bZIP transcription factor HBP-1b homolog identical to transcription factor HBP-1b homolog SP:P43273 from [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 ++K R+ +NR AA+ SR RKKA + ++E+ ++ + L Sbjct: 44 DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86 >At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-interacting protein VIP1 [Arabidopsis thaliana] GI:7258340, tbZIP transcription factor [Arabidopsis thaliana] GI:17065884 Length = 550 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/61 (22%), Positives = 32/61 (52%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 + K ++ L NR +A S++ ++ K+ +ME ++ + L + L+ N +++E Sbjct: 359 DAKKYKRMLANRASAARSKENREKKIRDMELRVETLENTQASLFGTMTLLEKENIVMMNE 418 Query: 467 N 469 N Sbjct: 419 N 419 >At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 513 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 368 EMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGPAESTPQQ 544 E++ Q+++F+ M+ R + + +A+ R +E+ + S P Q PA PQQ Sbjct: 243 EIQRQMQEFQRMHIRDQEQQQQQEAVYRRKSNEDGLIETGGGYFSPPYIQNPAPPPPQQ 301 >At5g32482.1 68418.m03835 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 341 Score = 29.5 bits (63), Expect = 3.0 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 4/74 (5%) Frame = +2 Query: 275 HLTWEEKMQR-KKLKNRVAAQTSRDRKKAKMDEMESQIRDFK---EMNERLTSEVESLKA 442 +LT E+ ++ +LKNR Q + KA+ D + +I+D+K E N L V L+ Sbjct: 69 YLTVEDPLELWLELKNRYDHQRTIQLPKAQHDWLNLRIQDYKSVEEYNSELFKIVSILRL 128 Query: 443 LNERLISENTALRE 484 E+ ++EN L + Sbjct: 129 CGEK-VTENDMLEK 141 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 347 RKKAKMDEMESQIRDFKEMNERLTSEVES 433 RK +++EME + DF+ NE+L +V++ Sbjct: 196 RKAHELNEMEELVSDFRAQNEKLLKKVQN 224 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/71 (23%), Positives = 31/71 (43%) Frame = +2 Query: 212 EDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRD 391 ++SD+ ++ + + H EE+ + KK KN+ S +K K + E + D Sbjct: 102 KESDVKVEEHEKEHKKGKEKKHEELEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHED 161 Query: 392 FKEMNERLTSE 424 + E L E Sbjct: 162 VSQEKEELEEE 172 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 3/83 (3%) Frame = +2 Query: 245 PSPSRKRR---LDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 P PS RR + + ++ K++K + RD+++ + ++S R MN+ L Sbjct: 45 PKPSSLRRQQLIRECSILANIEPKQIKVWFQNRRCRDKQRKEASRLQSVNRKLSAMNKLL 104 Query: 416 TSEVESLKALNERLISENTALRE 484 E + L+ +L+ EN +++ Sbjct: 105 MEENDRLQKQVSQLVCENGYMKQ 127 >At5g20490.1 68418.m02435 myosin, putative similar to myosin (GI:433663) [Arabidopsis thaliana]; myosin-like protein my5, common sunflower, PIR:T14279 Length = 1545 Score = 29.1 bits (62), Expect = 4.0 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKA--LNERLIS 463 E+ ++ R AA+ + + + E + D +++N LTSEVE+LKA ER + Sbjct: 952 EEANAAVIREREAARKAIEEAPPVIKETPVLVEDTEKINS-LTSEVEALKASLQAERQAA 1010 Query: 464 EN--TALREAAAAQS 502 EN A EA A S Sbjct: 1011 ENLRKAFSEAEARNS 1025 >At1g68640.1 68414.m07843 bZIP family transcription factor (PERIANTHIA) identical to transcription factor PERIANTHIA GB:AAD19660 GI:4378757 from [Arabidopsis thaliana] Length = 452 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERL 415 +++ R+ +NR AA+ SR RKKA + ++E+ ++ E L Sbjct: 164 DQRTLRRLAQNREAARKSRLRKKAYVQQLENSRIRLAQLEEEL 206 >At5g46880.1 68418.m05777 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to HD-Zip homeo domain OCL4 protein GI:8920425 from [Zea mays]; contains Pfam PF00046: Homeobox domain and Pfam PF01852: START domain Length = 820 Score = 28.7 bits (61), Expect = 5.3 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 9/114 (7%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKL--KNRVAAQTSRDRKKAKMDEMESQ 382 E D + + D P P++K+R T + + + L +N R R A++ Q Sbjct: 95 ESDVNELHDDEQPPPAKKKRYHRHTNRQIQEMEALFKENPHPDDKQRKRLSAELGLKPRQ 154 Query: 383 IRDFKEMNERLTSEVES-------LKALNERLISENTALREAAAAQSVPGGQGP 523 ++ F N R + + L+A N+ L SEN L+ S P GP Sbjct: 155 VK-FWFQNRRTQMKAQQDRNENVMLRAENDNLKSENCHLQAELRCLSCPSCGGP 207 >At5g06839.1 68418.m00773 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 417 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMES 379 + K R+ +NR AA+ SR RKKA + ++ES Sbjct: 116 DPKTLRRLAQNREAARKSRLRKKAYVQQLES 146 >At4g38900.1 68417.m05510 bZIP protein vsf-1 protein, Lycopersicon esculentum, PIR2:S52203 Length = 553 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/88 (23%), Positives = 44/88 (50%) Frame = +2 Query: 218 SDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFK 397 +D + ++A P R +R D L + L NR +A S++RK + E+E +++ + Sbjct: 384 NDKLAEMAMSDPKRVKRNDPLF-------RILANRQSAARSKERKMRYIVELEHKVQTLQ 436 Query: 398 EMNERLTSEVESLKALNERLISENTALR 481 L++++ L+ L ++N L+ Sbjct: 437 TEATTLSAQLTLLQRDMMGLTNQNNELK 464 >At4g25070.1 68417.m03596 expressed protein ; expression supported by MPSS Length = 765 Score = 28.7 bits (61), Expect = 5.3 Identities = 30/112 (26%), Positives = 47/112 (41%) Frame = +2 Query: 152 YEKMSAPIIITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAA 331 Y+K P I PNN +E+D + + + + LD L E KL+ A Sbjct: 379 YKKRYHPANILAPNNSNQQEDDRE--------ASALRDELDMLQEENDNIMDKLQR---A 427 Query: 332 QTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREA 487 + R+ +A+ E+E Q+ + E +V+ LK L ALR A Sbjct: 428 EERREAAEARAKELEKQV---ASLGEGANFDVKLLKRKEAALRQREAALRAA 476 >At2g11910.2 68415.m01278 expressed protein Length = 168 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = +1 Query: 313 EKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFEREVD*REHSATRSGG 492 E+++ ++D + +D + D+ +E S GGE + E E D + T GG Sbjct: 67 EENKDASDSDDDDDDEDADEDDDDEDDANDEDFS---GGEGDEGEEEADPEDDPVTNGGG 123 Query: 493 GAE 501 G++ Sbjct: 124 GSD 126 >At2g11910.1 68415.m01277 expressed protein Length = 168 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = +1 Query: 313 EKSRGSTDFSRQKESQDGRNGESDKGFQRNE*ASHK*GGELESFEREVD*REHSATRSGG 492 E+++ ++D + +D + D+ +E S GGE + E E D + T GG Sbjct: 67 EENKDASDSDDDDDDEDADEDDDDEDDANDEDFS---GGEGDEGEEEADPEDDPVTNGGG 123 Query: 493 GAE 501 G++ Sbjct: 124 GSD 126 >At1g73360.1 68414.m08491 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein protodermal factor2 (GI:14276060) [Arabidopsis thaliana]; similar to homeobox protein GI:1173621 from [ Phalaenopsis sp.] Length = 722 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/76 (26%), Positives = 39/76 (51%) Frame = +2 Query: 305 KKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 +K +N+++ + ++ K +++ K +ER ++ +LKA N+++ EN A+RE Sbjct: 59 EKQRNQLSRELGLAPRQIKF-WFQNRRTQLKAQHER--ADNSALKAENDKIRCENIAIRE 115 Query: 485 AAAAQSVPGGQGPAES 532 A P GP S Sbjct: 116 ALKHAICPNCGGPPVS 131 >At1g07330.1 68414.m00781 hypothetical protein Length = 685 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 209 EEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTS 340 E+D ++D+ + R +RL+HL +M+R R+AA++S Sbjct: 163 EDDQKNLMDLGNSEMERNKRLEHLITRRRMRRLV---RLAAESS 203 >At1g05230.2 68414.m00529 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to homeobox 1 (GP:12002853) {Picea abies}; Strong similarity to Phalaenopsis homeobox protein (gb|U34743) Length = 721 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 404 NERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGP 523 N E L+A NE+L ++N REA A S P GP Sbjct: 121 NHHERHENSHLRAENEKLRNDNLRYREALANASCPNCGGP 160 >At1g05230.1 68414.m00528 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to homeobox 1 (GP:12002853) {Picea abies}; Strong similarity to Phalaenopsis homeobox protein (gb|U34743) Length = 721 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 404 NERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGP 523 N E L+A NE+L ++N REA A S P GP Sbjct: 121 NHHERHENSHLRAENEKLRNDNLRYREALANASCPNCGGP 160 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = +2 Query: 344 DRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGP 523 D K ++ EME + +EM ++ E + A + I+ N A +E A+SV G Sbjct: 44 DEMKKRLKEMEDEAAALREMQAKVEKE---MGAQDPASIAANQAGKEEVDARSVFVGNVD 100 Query: 524 AESTPQQ 544 TP++ Sbjct: 101 YACTPEE 107 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +2 Query: 212 EDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMD---EMESQ 382 E S + ++ SP++K+++DH+ K + KK ++ A+ S+++ KA + E Sbjct: 370 EKSSKQIAKSTSSPAKKQKVDHVE-SSKEKSKKQPSKPQAKGSKEKGKATKKGKAKAEPT 428 Query: 383 IRDFKEMNERLTSEVE 430 ++ E+ ++ EV+ Sbjct: 429 RKEMLEVVSKILKEVD 444 >At5g44180.1 68418.m05406 homeobox transcription factor, putative similar to homeobox transcription factor Hox7/homeotic protein Hox7 (GI:19486) {Lycopersicon peruvianum}; similar to GP|4165087| Williams-Beuren syndrome deletion transcript 9 [Homo sapiens]; contains Pfam PF02791: DDT domain and Pfam PF00046: Homeobox domain Length = 1694 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 257 RKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ-IRDFKEMNERLTSEVES 433 R++ + L E++ + ++ + R K K + + ++ +R +EM R EV Sbjct: 375 RRKEEERLLREKQREEERYLKEQMRELQRREKFLKKETIRAEKMRQKEEM--RKEKEVAR 432 Query: 434 LKALNERLISENTA 475 LKA NER I+ A Sbjct: 433 LKAANERAIARKIA 446 Score = 27.9 bits (59), Expect = 9.2 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 7/105 (6%) Frame = +2 Query: 131 SLIEW-SDYEKMSAPIIITVPNNYLVKEE----DSDMILDVASPSPSRKRRLDHLTWEEK 295 +L+E+ S Y+K V ++ VK E + D D RK + E + Sbjct: 281 NLVEYDSPYQKSYMDTAAQVHDDPFVKSEREVGNEDEDDDALQLERHRKNEEARIAREVE 340 Query: 296 MQRKKLKNRVAAQTSRDRKKAKM--DEMESQIRDFKEMNERLTSE 424 K+++ + Q RK+ + EME Q R+ ++ ERL E Sbjct: 341 AHEKRIRRELEKQDMLRRKREEQIRKEMERQDRERRKEEERLLRE 385 >At5g23570.1 68418.m02765 XS domain-containing protein / XS zinc finger domain-containing protein-related contains Pfam profiles PF03468: XS domain, weak hit to PF03470: XS zinc finger domain Length = 625 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/59 (25%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDF----KEMNERLTSEVESLKALNER 454 EK++R NR+ Q ++ + + +EM++ R F K+++ER ++ E+ + L ++ Sbjct: 474 EKLRRTAEDNRIVRQRTKMQHEQNREEMDAHDRFFMDSIKQIHERRDAKEENFEMLQQQ 532 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/77 (23%), Positives = 36/77 (46%) Frame = +2 Query: 287 EEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 EEK +RKK + + ++ + K ++ +S ++ + E E E+ + E I E Sbjct: 331 EEKPERKKKEESSSQGEGKEEEPEKREKEDSSSQEESKEEEPENKEKEASSSQEENEIKE 390 Query: 467 NTALREAAAAQSVPGGQ 517 T ++E + S G + Sbjct: 391 -TEIKEKEESSSQEGNE 406 >At4g16570.1 68417.m02508 protein arginine N-methyltransferase-related contains weak similarity to protein arginine N-methyltransferase 2 (EC 2.1.1.-) (Swiss-Prot:P55345) [Homo sapiens] Length = 724 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 380 DSPFRPSWLSFCREKSVLPRDFSVSFFAFFLPMSDGP 270 DSP P ++ C E +L ++F+V F F P++ GP Sbjct: 603 DSPCLPFFIWQCGETKILSKEFTVMEFDFSKPIT-GP 638 >At3g09670.1 68416.m01146 PWWP domain-containing protein Length = 726 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 286 GRKNAKKETEKSRGSTDFSRQKESQDGRNGESDK 387 G N KETE G D + E+ G + +SDK Sbjct: 63 GFTNLVKETESVNGELDLGTRTENVGGESNQSDK 96 >At2g30500.1 68415.m03715 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 517 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/75 (26%), Positives = 36/75 (48%) Frame = +2 Query: 260 KRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLK 439 K +L H E + +L+ AA+ ++ K+ E+E RD +L +E + + Sbjct: 273 KEKLQHFEKETYSLKNELEIGKAAE---EKLKSLQHELELAQRDADTYINKLNAEKKEVL 329 Query: 440 ALNERLISENTALRE 484 L ERL T+L++ Sbjct: 330 KLQERLAMVKTSLQD 344 >At1g04440.1 68414.m00435 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395; contains protein kinase domain, Pfam:PF00069 Length = 468 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 611 TSSRNSIPRNTSTPYMNLQTPSSXK 685 +SS NS PR T P MN+ PS+ K Sbjct: 301 SSSSNSKPRPTLRPAMNIPVPSADK 325 >At5g49470.2 68418.m06121 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 834 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 214 RFGYDSRCSVTVSVQETATGPSDMGRKNAKKETEKSRGSTDFSRQKESQDGRNGESDKGF 393 + G DS+ + V++ A+ SD+ K K K R + + E G + +SD+GF Sbjct: 256 KLGLDSQQPIQVAI---ASKISDLASKVGNKVKSKMRAGDNNAANLEGGSGDSHQSDQGF 312 >At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family protein Length = 511 Score = 27.9 bits (59), Expect = 9.2 Identities = 22/86 (25%), Positives = 43/86 (50%) Frame = +2 Query: 245 PSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSE 424 P+ R + L+H+ E+M+R+KL +R A + +KMD+ S + D L S+ Sbjct: 334 PAHGRDKPLNHVE-AERMRREKLNHRFYALRAVVPNVSKMDK-TSLLEDAVCYINELKSK 391 Query: 425 VESLKALNERLISENTALREAAAAQS 502 E+++ + + L+E A ++ Sbjct: 392 AENVELEKHAIEIQFNELKEIAGQRN 417 >At5g20470.1 68418.m02433 myosin, putative similar to PIR|T00727 myosin heavy chain PCR43 [Arabidopsis thaliana] Length = 556 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 311 LKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALREAA 490 ++ R AA+ + + + E+ + D +++N LTSEVE+LKA + A E Sbjct: 164 VREREAARKAIEEAPPVIKEIPVLVEDTEKINS-LTSEVEALKAERQAAEHLEKAFSETE 222 Query: 491 AAQS 502 A S Sbjct: 223 ARNS 226 >At4g39690.1 68417.m05616 expressed protein Length = 650 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 3/85 (3%) Frame = +2 Query: 212 EDSDMILDVASPSPSRKRRLDHL---TWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQ 382 ED ++LD + + +++ HL + E+++ K K + R R+ +++E + Sbjct: 321 EDGKLVLDFLAAIHAAEKQQAHLDAQVFAEELRALKEKYENELRDLRARELMRIEE--AA 378 Query: 383 IRDFKEMNERLTSEVESLKALNERL 457 I D KE+ T ++KA+ ER+ Sbjct: 379 ILD-KELKRERTKAAAAIKAIQERM 402 >At3g44790.1 68416.m04823 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 324 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/101 (20%), Positives = 45/101 (44%) Frame = +2 Query: 221 DMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKE 400 D+ +D + R L ++ +KL+ + K++M E+E +++ FK+ Sbjct: 220 DISIDDLGQAEKALRYLKDSDFKVDWLERKLEEVKEKKMEEQIGKSRMQELEEELKIFKQ 279 Query: 401 MNERLTSEVESLKALNERLISENTALREAAAAQSVPGGQGP 523 S++E+ ++ S+ AL E A+S+ + P Sbjct: 280 K----CSDIEAQLEKEKQKCSDIEALLEKEKAKSLAAARAP 316 >At3g43530.1 68416.m04621 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 615 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +2 Query: 305 KKLKNRVAA---QTSRDRKKAKMDEMESQIRD-FKEMNERLTSEVESLKALNERLISENT 472 KK K + AA S + ++EM++ + + FK MN+R+T+ + + ++RL T Sbjct: 343 KKGKGKTAAALTSPSDEGLTEVVNEMKNLMENGFKSMNKRMTNFSKKYEEQDKRLKLMET 402 Query: 473 ALREAAAAQSVPGGQGPAESTPQQKE 550 A++ ++ G E ++ E Sbjct: 403 AIKSIQSSTGTDDAYGSKEIDDRENE 428 >At3g05130.1 68416.m00557 expressed protein ; expression supported by MPSS Length = 634 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +2 Query: 290 EKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDFKEMNERLTSEVESLKALNERLISE 466 EKM K L+ + R + +++ESQ K N +L E+ L+ E L +E Sbjct: 466 EKMVAKTLEELEKVKIERKSLFSAKNDLESQSESLKSENVKLEKELVELRKAMEALKTE 524 >At2g31600.2 68415.m03861 expressed protein Length = 216 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +2 Query: 266 RLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDF 394 R H+T E ++R+ + A+ RD A M+++++Q RD+ Sbjct: 74 RSSHITRSELLKRRSHNLKQLAKCYRDNYWALMEDVKAQHRDY 116 >At2g31600.1 68415.m03860 expressed protein Length = 301 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +2 Query: 266 RLDHLTWEEKMQRKKLKNRVAAQTSRDRKKAKMDEMESQIRDF 394 R H+T E ++R+ + A+ RD A M+++++Q RD+ Sbjct: 74 RSSHITRSELLKRRSHNLKQLAKCYRDNYWALMEDVKAQHRDY 116 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 27.9 bits (59), Expect = 9.2 Identities = 28/103 (27%), Positives = 47/103 (45%) Frame = +2 Query: 176 IITVPNNYLVKEEDSDMILDVASPSPSRKRRLDHLTWEEKMQRKKLKNRVAAQTSRDRKK 355 I +VP+N V E++SD+ + +K + W+E M K ++NR +K Sbjct: 532 IDSVPSN--VSEKESDISFN-GEQQEDQKEKEGEPDWKE-MFMKGMENR---------EK 578 Query: 356 AKMDEMESQIRDFKEMNERLTSEVESLKALNERLISENTALRE 484 + E + +R+FK+M + L +K N E LRE Sbjct: 579 HLLTEYTTILRNFKDMKKTLDETKTKMKTENATKDDEIKLLRE 621 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,022,077 Number of Sequences: 28952 Number of extensions: 300909 Number of successful extensions: 1328 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -