BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G19 (842 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 25 0.99 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 5.3 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.6 bits (51), Expect = 0.99 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 219 YIDALQLQVRVSMVGTGGV---DAVLVGDDLPELSSN 118 +++ALQ +SM+G GV A LV D + +S N Sbjct: 111 FMEALQAGADISMIGQFGVGFYSAYLVADKVTVVSKN 147 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 112 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 234 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 333 RTEDLSERSGADRVHGAGLQVDEDGAG 253 + DLS R+G+ H L + + G G Sbjct: 196 KARDLSPRNGSPTDHSPVLNLSKSGGG 222 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,836 Number of Sequences: 336 Number of extensions: 3358 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -