BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G12 (1063 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 29 5.2 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +2 Query: 179 TTTLSGRADVTSFFNTQMVFDLKEESGELIKSPSPPPSHDGSASGEGEISGD 334 T L G +F ++ VF+L G LI SPS PSH S E + +GD Sbjct: 44 TLQLMGCKARHAFKISRRVFELIRSEGSLILSPSLSPSH--SKESEFQKTGD 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,849,293 Number of Sequences: 28952 Number of extensions: 147086 Number of successful extensions: 656 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2627750416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -