BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G08 (837 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 93 2e-21 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 93 2e-21 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 87 2e-19 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 4.0 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 4.0 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 93.5 bits (222), Expect = 2e-21 Identities = 47/59 (79%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +1 Query: 610 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVNHRR-RXHLGGE 783 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEV HLGGE Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGE 59 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 93.5 bits (222), Expect = 2e-21 Identities = 47/59 (79%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +1 Query: 610 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVNHRR-RXHLGGE 783 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEV HLGGE Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGE 59 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 86.6 bits (205), Expect = 2e-19 Identities = 43/59 (72%), Positives = 50/59 (84%), Gaps = 1/59 (1%) Frame = +1 Query: 610 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFE-VNHRRRXHLGGE 783 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FE V HLGGE Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLGGE 58 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 152 LPAREGGDHRQRPGQQDH 205 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 565 TKDAGTISGLNVLRIINEPTAA 630 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,598 Number of Sequences: 336 Number of extensions: 4209 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -