BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G05 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 59 4e-11 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 59 4e-11 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 56 5e-10 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 59.3 bits (137), Expect = 4e-11 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +2 Query: 617 IXEPTAAXIAYXLDXKGTGXRNVLIFDLGGGTFXVSILT 733 I EPTAA IAY LD K RNVLIFDLGGGTF VS+LT Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLT 39 Score = 35.5 bits (78), Expect = 5e-04 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 733 IEDGIXEVKSPPA-TPLGGEDFDNRXV 810 IE+GI EVK+ T LGGEDFDNR V Sbjct: 40 IEEGIFEVKATAGDTHLGGEDFDNRLV 66 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 59.3 bits (137), Expect = 4e-11 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +2 Query: 617 IXEPTAAXIAYXLDXKGTGXRNVLIFDLGGGTFXVSILT 733 I EPTAA IAY LD K RNVLIFDLGGGTF VS+LT Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLT 39 Score = 35.5 bits (78), Expect = 5e-04 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 733 IEDGIXEVKSPPA-TPLGGEDFDNRXV 810 IE+GI EVK+ T LGGEDFDNR V Sbjct: 40 IEEGIFEVKATAGDTHLGGEDFDNRLV 66 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 55.6 bits (128), Expect = 5e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 617 IXEPTAAXIAYXLDXKGTGXRNVLIFDLGGGTFXVSILT 733 I EPTAA IAY LD KG +N+L++DLGGGTF VSILT Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILT 38 Score = 25.8 bits (54), Expect = 0.44 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 733 IEDGIXEVKSPPA-TPLGGEDFDNR 804 I++G+ EV + T LGGEDFD + Sbjct: 39 IDNGVFEVVATSGDTHLGGEDFDQK 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,785 Number of Sequences: 336 Number of extensions: 2653 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -