BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_G02 (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23G7.06c |||conserved eukaryotic protein|Schizosaccharomyces... 27 2.5 SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 27 3.3 SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosacchar... 27 4.4 SPBC2G5.06c |hmt2|cad1|sulfide-quinone oxidoreductase|Schizosacc... 26 5.8 SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr... 26 7.7 SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccha... 26 7.7 SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizos... 26 7.7 SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|c... 26 7.7 SPAC24H6.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 7.7 >SPBC23G7.06c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 745 Score = 27.5 bits (58), Expect = 2.5 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 7/75 (9%) Frame = +2 Query: 353 QFIAKEAGALFDSSLLEDT-PSSSTNGT----ETLVPE--DNLYALMPPFETFLNVDKTA 511 +F+ ++G++ + +D P SS++ +T+ P +N Y + P + + + Sbjct: 64 KFLQGKSGSVKVQEIPQDQLPKSSSDNAVTDRKTISPSGINNQYVIRNPKDVYYATVQAG 123 Query: 512 RLRHFFDNVKTGELI 556 +L H FD VKT EL+ Sbjct: 124 KL-HLFDPVKTSELL 137 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 27.1 bits (57), Expect = 3.3 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +2 Query: 389 SSLLEDTPSSSTNGTETLVPEDNLYALMPPFETFLNVDKTARLRHFFDNVKTGELIIGAV 568 SSL +PS ST G E + +D Y L+ +E ++ A + H F + + A Sbjct: 1603 SSLRNVSPSESTGGYEGCIFDDQQYQLL--YELCERLEDHAAILHGFPEPPPCDTGLAAP 1660 Query: 569 INR 577 +N+ Sbjct: 1661 VNQ 1663 >SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosaccharomyces pombe|chr 1|||Manual Length = 556 Score = 26.6 bits (56), Expect = 4.4 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 284 FAVYQSRHKHLTFQDRSKRLKLHQFIAKEAGALFDS-SLLEDTPS 415 + +YQ H HL + + R +H+F+ A AL +S LL D+ S Sbjct: 321 YELYQ--HSHLGYGLKEARKLIHKFVLNNAEALKESLELLGDSTS 363 >SPBC2G5.06c |hmt2|cad1|sulfide-quinone oxidoreductase|Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 26.2 bits (55), Expect = 5.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 608 CTAGPTSRYVADINVKAFLPVGNIIQAVDKKNVSRNY 718 C+ PTS+ A I +A + V N+ V+ KN++ +Y Sbjct: 341 CSGLPTSKTYAAITAQAPVMVHNLWSFVNGKNLTASY 377 >SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr 3|||Manual Length = 1024 Score = 25.8 bits (54), Expect = 7.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 410 PSSSTNGTETLVP 448 P+ STNGTET +P Sbjct: 547 PNGSTNGTETFIP 559 >SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 473 PPFETFLNVDKTARLRHFFDNVKTGELIIGAVINRTASGMMLKV 604 P F FLN+DK F+ + EL G++ R S + KV Sbjct: 35 PSFADFLNMDKPLTADEAFELDRKVELPNGSIHKRLPSWLKTKV 78 >SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 449 Score = 25.8 bits (54), Expect = 7.7 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 112 NVTT*LRAGKKRI*MDPLLDASL 180 NV T L K+R+ +DPL+D SL Sbjct: 271 NVVTCLDCKKERVAVDPLMDISL 293 >SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 25.8 bits (54), Expect = 7.7 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 184 PLRTHPIKDPFKFFFSQHEVMLLRFQKNSVNVIMIEKKPIQ*SSEMATNE 35 P HPI P SQH+ + +K +V I+ K P SS A ++ Sbjct: 101 PRPMHPISHPL----SQHKTPEFKHRKRNVESILTPKNPSLFSSSNAASQ 146 >SPAC24H6.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 220 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 612 VQRTLSIIPDAVLLITAPMISSPVFTLSKKCLNLAVLSTFRNVSNGGIN 466 + R++S+ P I+ P ISS L KK + + +TF + +N +N Sbjct: 74 MNRSISVPPTN---ISVPQISSNPLNLMKKSSDNDIFTTFNDTTNDCMN 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,371,700 Number of Sequences: 5004 Number of extensions: 68280 Number of successful extensions: 176 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -