SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_FL5_F23
         (839 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_54268| Best HMM Match : Vicilin_N (HMM E-Value=0.077)               29   6.2  

>SB_54268| Best HMM Match : Vicilin_N (HMM E-Value=0.077)
          Length = 371

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 16/48 (33%), Positives = 29/48 (60%)
 Frame = +3

Query: 468 NDLLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVDPQPRQR 611
           +DL++QL+ Q  + N + + LEEK  L    EN+ +  E++  + RQ+
Sbjct: 178 DDLMRQLEQQKNERNSYVDILEEKSTLE---ENLRQEREQLHEKLRQK 222


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,716,327
Number of Sequences: 59808
Number of extensions: 466281
Number of successful extensions: 1097
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1093
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2371447782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -