BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F23 (839 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81577-3|CAB04649.1| 528|Caenorhabditis elegans Hypothetical pr... 31 0.77 Z83233-8|CAB05759.2| 378|Caenorhabditis elegans Hypothetical pr... 29 3.1 AC024875-5|AAM44401.1| 203|Caenorhabditis elegans Rab family pr... 28 7.2 AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trn... 25 7.6 AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trn... 25 7.6 AF016685-16|AAG24152.2| 328|Caenorhabditis elegans Serpentine r... 28 9.5 >Z81577-3|CAB04649.1| 528|Caenorhabditis elegans Hypothetical protein R11.3 protein. Length = 528 Score = 31.5 bits (68), Expect = 0.77 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 663 PAAXLQWAARSQKTEARTAAGVVGPRVQELQ--KCFRRSKGGQLFPLTSWRK 514 PA L WA RSQ + A V P V + Q K +R+ KG L W + Sbjct: 405 PAMKLAWALRSQLESEQAPAAVFDPMVVDKQQRKKYRKKKGTNLDYKMIWEE 456 >Z83233-8|CAB05759.2| 378|Caenorhabditis elegans Hypothetical protein K06B4.8 protein. Length = 378 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 179 KTPTSLDINPSGLLFAFVELNHYNNEC 259 KTP LD +L+ F+ELN N EC Sbjct: 232 KTPALLDQTSCMVLYKFIELNITNEEC 258 >AC024875-5|AAM44401.1| 203|Caenorhabditis elegans Rab family protein 18, isoform b protein. Length = 203 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 468 NDLLQQLDSQCKQENIFSNWLEEKVDLPS 554 N +Q++D+ C +NI + K+D+P+ Sbjct: 103 NHWMQEVDTYCTNDNIIKMMVANKIDMPN 131 >AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform a protein. Length = 909 Score = 24.6 bits (51), Expect(2) = 7.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 322 CSKLRISSMMIVICLKTFRALQRRSKSITPR 414 C LRI M + LK F +++ + TPR Sbjct: 559 CGTLRIQGMKMSKSLKNFITIRKALEDYTPR 589 Score = 21.8 bits (44), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 295 CSLTMSAVCCSKLRI 339 CS+ SA+C SKL I Sbjct: 510 CSVMSSAICGSKLDI 524 >AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform b protein. Length = 908 Score = 24.6 bits (51), Expect(2) = 7.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 322 CSKLRISSMMIVICLKTFRALQRRSKSITPR 414 C LRI M + LK F +++ + TPR Sbjct: 558 CGTLRIQGMKMSKSLKNFITIRKALEDYTPR 588 Score = 21.8 bits (44), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 295 CSLTMSAVCCSKLRI 339 CS+ SA+C SKL I Sbjct: 509 CSVMSSAICGSKLDI 523 >AF016685-16|AAG24152.2| 328|Caenorhabditis elegans Serpentine receptor, class x protein1 protein. Length = 328 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 337 ISSMMIVICLK-TFRALQRRSKSITPRVSTRHHRRS*NQ 450 +SS++ VIC F ++ KSITP ++ H +R Q Sbjct: 186 LSSIVPVICYSWIFYTIRSAHKSITPNMAPEHQKRQGRQ 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,488,281 Number of Sequences: 27780 Number of extensions: 344277 Number of successful extensions: 983 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2077023564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -