BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F22 (848 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transpor... 27 0.95 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 27 0.95 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 2.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 6.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 6.7 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 24 6.7 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 24 6.7 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 24 6.7 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 6.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.9 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 8.9 >AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transporter protein. Length = 156 Score = 26.6 bits (56), Expect = 0.95 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 Query: 323 CLWLEEHPG 349 CLWL+EHPG Sbjct: 46 CLWLQEHPG 54 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 26.6 bits (56), Expect = 0.95 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 Query: 323 CLWLEEHPG 349 CLWL+EHPG Sbjct: 460 CLWLQEHPG 468 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.4 bits (53), Expect = 2.2 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 148 GQRWRCPQWPWHLANYMSQPPTKLPRSPPSSKRGSLEPRPR 270 G RW + P S PT PRS P+SK L R R Sbjct: 265 GGRWPSCRSPPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 6.7 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 155 GGGARSGRGISQTTCLNHPQSCRDLHHPRRE 247 GGG R+G G+ T Q+ R HH E Sbjct: 566 GGGGRAGGGVGATGAEKQQQN-RSNHHRTTE 595 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 6.7 Identities = 10/14 (71%), Positives = 12/14 (85%), Gaps = 1/14 (7%) Frame = +1 Query: 202 QPPTKLPR-SPPSS 240 QPP K+PR +PPSS Sbjct: 319 QPPEKMPRLNPPSS 332 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 351 QPGCSSSHKHERYHHQCSRHDQ 286 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 351 QPGCSSSHKHERYHHQCSRHDQ 286 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 351 QPGCSSSHKHERYHHQCSRHDQ 286 +P S+ H+H HH R ++ Sbjct: 20 EPSASTKHRHHSRHHHRRRRER 41 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.8 bits (49), Expect = 6.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 204 LRHVVCEMPRPLRAPPPLTWVAALGKRLATEPAIRAEISDIFHKLI 67 L H+V ++ PPL W A +P A++SD KLI Sbjct: 379 LEHIVSDL---FPQHPPLVWPEAADIEGEEQPGAVADVSDDELKLI 421 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -3 Query: 369 RTPPS-PQPGCSSSHKHERYHHQCSRH 292 R PPS + +SSH H HH H Sbjct: 1299 RLPPSRSEDTLNSSHLHHHLHHGHHHH 1325 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.4 bits (48), Expect = 8.9 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 717 DGHQ*STHADHGQXVPES-QQP*YQSA*AH 631 DG+Q T+ HG+ P S Q+P Y ++ A+ Sbjct: 256 DGNQMDTNQMHGEVAPVSYQEPPYWASIAY 285 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,541 Number of Sequences: 2352 Number of extensions: 18505 Number of successful extensions: 63 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -