BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F22 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 1.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 1.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 4.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 6.2 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 22 6.2 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 8.2 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 8.2 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 608 TWRLNTDPHTGFRVDWSLAINR 543 T +L+TDP+T F+V+ S I R Sbjct: 680 TEKLSTDPNTHFQVNQSHGIKR 701 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 527 YYTPKDLLSDGNVYDSTSTLDNISFLDK 444 +Y P+DL ++Y++ L+ SF K Sbjct: 346 FYHPEDLPFIKDIYETVIKLEGASFRSK 373 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 10 SGSTATSRERSNWLSVCHNYKFVKNVADLRSY 105 S S S+ WL V NYK + A R Y Sbjct: 431 STSAGFSQTNKTWLPVNENYKSLNLAAQKREY 462 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 4.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 32 ASGVTGFPSATIISL*KMSLISARIAGSVARRLPNAA 142 +SGV A +S+ +S+I+AR AG NAA Sbjct: 628 SSGVLAKKVADRVSMLMISVITARHAGEYVCTAENAA 664 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 6.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -3 Query: 252 GSSLRGWWRSRQLCGWLRHVVCEMPRPLRAPPPL 151 GS L R +CG + + + +P P R PL Sbjct: 467 GSLLNPSHMYRAVCGRIENTIQGLPPPYRLNKPL 500 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 527 YYTPKDLLSDGNVYDSTSTLDNISFLDK 444 +Y P+DL ++Y++ L+ SF K Sbjct: 52 FYHPEDLPFIKDIYETVIKLEGASFRSK 79 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 10 SGSTATSRERSNWLSVCHNYKFVKNVAD 93 S S S + WL V NYK V A+ Sbjct: 425 SVSAGFSSSSNTWLRVNENYKTVNLAAE 452 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 10 SGSTATSRERSNWLSVCHNYKFVKNVAD 93 S S S + WL V NYK V A+ Sbjct: 425 SVSAGFSSSSNTWLRVNENYKTVNLAAE 452 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 232,604 Number of Sequences: 438 Number of extensions: 5836 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -