BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F16 (893 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) 83 3e-16 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 80 2e-15 SB_46434| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_6601| Best HMM Match : Kinesin (HMM E-Value=1.5e-05) 71 1e-12 SB_36042| Best HMM Match : Kinesin (HMM E-Value=0) 70 2e-12 SB_21941| Best HMM Match : Kinesin (HMM E-Value=0) 70 3e-12 SB_51400| Best HMM Match : Kinesin (HMM E-Value=0) 69 4e-12 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 69 4e-12 SB_42855| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_47077| Best HMM Match : Kinesin (HMM E-Value=1.7e-27) 68 1e-11 SB_11767| Best HMM Match : Kinesin (HMM E-Value=0) 67 2e-11 SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 66 4e-11 SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_12394| Best HMM Match : Kinesin (HMM E-Value=1.3e-38) 66 5e-11 SB_51895| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39634| Best HMM Match : Kinesin (HMM E-Value=9.9e-39) 64 1e-10 SB_54210| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7436| Best HMM Match : Kinesin (HMM E-Value=0.00023) 61 1e-09 SB_40388| Best HMM Match : Kinesin (HMM E-Value=0) 60 2e-09 SB_20166| Best HMM Match : Kinesin (HMM E-Value=0) 55 7e-08 SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 9e-08 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) 51 1e-06 SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) 51 1e-06 SB_29744| Best HMM Match : Kinesin (HMM E-Value=6.3e-30) 50 3e-06 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18382| Best HMM Match : Kinesin (HMM E-Value=2.3e-14) 44 2e-04 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 44 2e-04 SB_40762| Best HMM Match : Kinesin (HMM E-Value=8.5e-15) 43 4e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_50557| Best HMM Match : Kinesin (HMM E-Value=9.6e-24) 41 0.001 SB_11127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_25681| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 33 0.31 SB_43995| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) 31 0.95 SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_14255| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 >SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) Length = 711 Score = 83.0 bits (196), Expect = 3e-16 Identities = 41/76 (53%), Positives = 55/76 (72%) Frame = +1 Query: 187 EDSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGGKVYLFDKVFKPNATQEKVY 366 E +I+V CRFRP +D+E KAG + +VKFP+ D I GG+ + FD+VFKP ATQEKVY Sbjct: 10 ECNIKVFCRFRPQSDAETKAGGQIVVKFPT--PDTAIH-GGRTFTFDRVFKPTATQEKVY 66 Query: 367 NEAAKSIVSDVLAGYN 414 +EAA++IV +A N Sbjct: 67 SEAAQAIVQGKIAQEN 82 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +2 Query: 512 IVNDIFXHIYAMXENLXXHIK 574 IV DIF HIY M ENL HIK Sbjct: 99 IVQDIFNHIYNMDENLEFHIK 119 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 80.2 bits (189), Expect = 2e-15 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 6/113 (5%) Frame = +1 Query: 190 DSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGG------KVYLFDKVFKPNAT 351 +++RV+ R RPLN E+ + +++ S + G K + FD + ++T Sbjct: 3 EAVRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDKTQPPKAFTFDGAYFIDST 62 Query: 352 QEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPR 510 E +YN+ +V VL GYNGT+FAYGQT GK+ +M G+ P ++GIIPR Sbjct: 63 TENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPR 115 >SB_46434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 873 Score = 77.4 bits (182), Expect = 1e-14 Identities = 48/117 (41%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Frame = +1 Query: 154 KKMAADREIAAEDSIRVVCRFRPLNDSEEKAG--SKFIVKFPSGPDD--NCISIGG-KVY 318 +K + I + +IRV CR RP+ E+ AG ++ ++ F D N S G K + Sbjct: 305 RKKYLNELIELKGNIRVYCRVRPVI-REDGAGKPAENVISFDDDDDAILNVFSRGALKPF 363 Query: 319 LFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 D+VF+P +TQ +V+ E K +V + GYN IFAYGQT SGKT TMEG + +PG Sbjct: 364 EMDRVFQPQSTQVEVFEEV-KPLVISCVDGYNVCIFAYGQTGSGKTFTMEGPVSNPG 419 >SB_6601| Best HMM Match : Kinesin (HMM E-Value=1.5e-05) Length = 161 Score = 71.3 bits (167), Expect = 1e-12 Identities = 44/99 (44%), Positives = 59/99 (59%), Gaps = 5/99 (5%) Frame = +1 Query: 190 DSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPD---DNCISIGG-KVYLFDKVFKPNATQE 357 D+IRVV R RPLN SE++ SK I+K P DN S G K + F+ V N +Q Sbjct: 34 DNIRVVVRVRPLNSSEKEKASKNIIKLPGDGAIWIDN--SFGQIKPFTFNVVLAENTSQA 91 Query: 358 KVYNEAA-KSIVSDVLAGYNGTIFAYGQTSSGKTHTMEG 471 +++ E K +V+ L GY+ T FA+GQT SGKT T+ G Sbjct: 92 EMFEECGIKHLVNMALEGYSCTAFAFGQTGSGKTFTITG 130 >SB_36042| Best HMM Match : Kinesin (HMM E-Value=0) Length = 292 Score = 70.1 bits (164), Expect = 2e-12 Identities = 41/115 (35%), Positives = 60/115 (52%), Gaps = 3/115 (2%) Frame = +1 Query: 175 EIAAEDSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGGKVYLFDKVFKPNATQ 354 ++ + S+RV R RP + SE+ + G + K + FD VF A Q Sbjct: 4 KVVDDTSVRVALRIRPQSASEQIDMCRVCTSCTPGHPQVVLG-KDKGFTFDYVFDIPAKQ 62 Query: 355 EKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTME---GVIGDPGKQGIIPR 510 ++Y + K +V L GYN T+ AYGQT +GKT+TM V DP ++GI+PR Sbjct: 63 PEIYEKCVKELVEGCLDGYNATVLAYGQTGAGKTYTMGTGFDVNIDPLEEGIVPR 117 >SB_21941| Best HMM Match : Kinesin (HMM E-Value=0) Length = 791 Score = 69.7 bits (163), Expect = 3e-12 Identities = 33/70 (47%), Positives = 44/70 (62%) Frame = +1 Query: 331 VFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPR 510 +++ EK+Y+E IV VL GYNGT+FAYGQTS GKT TM+G + GI PR Sbjct: 331 LWRTKCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPR 390 Query: 511 XCQ*HIXSHL 540 C+ HI + + Sbjct: 391 CCR-HILNSM 399 >SB_51400| Best HMM Match : Kinesin (HMM E-Value=0) Length = 455 Score = 69.3 bits (162), Expect = 4e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = +1 Query: 343 NATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ 519 NA+QE VY E A+ +V+ L GYNGT+ AYGQT SGKT TM G +GIIPR Q Sbjct: 63 NASQETVYEECARKLVTSTLDGYNGTVMAYGQTGSGKTFTMTGSTEKFEHRGIIPRSIQ 121 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 69.3 bits (162), Expect = 4e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = +1 Query: 343 NATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ 519 NA+QE VY E A+ +V+ L GYNGT+ AYGQT SGKT TM G +GIIPR Q Sbjct: 63 NASQETVYEECARKLVTSTLDGYNGTVMAYGQTGSGKTFTMTGSTEKFEHRGIIPRSIQ 121 >SB_42855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 68.1 bits (159), Expect = 9e-12 Identities = 43/100 (43%), Positives = 58/100 (58%), Gaps = 1/100 (1%) Frame = +1 Query: 193 SIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGG-KVYLFDKVFKPNATQEKVYN 369 +IRV CR R + + E A V FPS + + G K ++FD+VF P++TQE+V+ Sbjct: 489 NIRVFCRCRR-DPTVEVA-----VTFPSDQEIQAVGPSGRKTFMFDRVFTPDSTQEQVFE 542 Query: 370 EAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 + I S V GYN I AYGQT +GKT TM G +PG Sbjct: 543 DTLPLIASCV-DGYNVCIMAYGQTGAGKTFTMMGPEDNPG 581 >SB_47077| Best HMM Match : Kinesin (HMM E-Value=1.7e-27) Length = 212 Score = 67.7 bits (158), Expect = 1e-11 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = +1 Query: 310 KVYLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 K Y+FD F P A+Q +V+++ K ++ V++GYN T+FAYG T +GKT+TM G + G Sbjct: 51 KQYVFDHAFGPTASQVEVFSKTTKPLIDGVVSGYNATVFAYGATGAGKTYTMLGTDSEIG 110 Query: 490 KQGI 501 G+ Sbjct: 111 IMGL 114 >SB_11767| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1230 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = +1 Query: 316 YLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG-- 489 + FD VF+P+A+Q +VY + +V L GYN T+FAYGQT SGKT+T+ G+ D G Sbjct: 630 FTFDYVFQPDASQVEVYESCIEPLVKSCLEGYNATVFAYGQTGSGKTYTIGGL--DTGGL 687 Query: 490 ---KQGIIPR 510 + GIIPR Sbjct: 688 MDDQYGIIPR 697 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 515 VNDIFXHIYAMXENLXXHIKVSYFEIYMDKIXXLLDXVQSKSPVSM-XXKKXXPIXXXVL 691 V IF + + + VSY EIY++++ LLD S + + K + + Sbjct: 699 VKQIFQAFEESKQKIVFEVHVSYIEIYLEELRDLLDLDTSSKDIHIREDDKGNTVVVGAM 758 Query: 692 PEPI 703 +P+ Sbjct: 759 EQPV 762 >SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1175 Score = 66.5 bits (155), Expect = 3e-11 Identities = 52/154 (33%), Positives = 77/154 (50%), Gaps = 14/154 (9%) Frame = +1 Query: 193 SIRVVCRFRP----------LNDSEEKAGSKFIVKFPSGPDDNCISIGGKV---YLFDKV 333 +IRV CR RP +N S + G + + P+D + G + FDKV Sbjct: 221 NIRVFCRVRPPLPNEMNKDLVNVSLQDEGRGIAITPSNLPEDVMATKKGVSKYEFSFDKV 280 Query: 334 FKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRX 513 F+ + Q +V+ E ++ +V L GYN IFAYGQT SGKT+TMEG + +G+IPR Sbjct: 281 FQHTSKQAQVFEEISQ-LVQSALDGYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRS 339 Query: 514 CQ*HIXSHLCHXRELGXXY-*SVIF*NLYGQDXR 612 + + + +E G Y V F +Y + R Sbjct: 340 ME-QVFLNTHKLQEKGWKYKMDVSFLEIYNETIR 372 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 66.1 bits (154), Expect = 4e-11 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = +1 Query: 190 DSIRVVCRFRPLNDSEEKAGSKFIVK-FPSGPDDNCISIGGKVYLFDKVFKPNATQEKVY 366 D +RV R RP ++ E + G V+ P + + + ++FD V P AT +VY Sbjct: 15 DRVRVFVRVRPRSEDEVRRGEPPGVEVIPIRNEIVLVDGRERRFVFDAVLPPAATNRQVY 74 Query: 367 NEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTM 465 + A + +V +G+NGT+ AYGQT +GKT+TM Sbjct: 75 SYAGRPLVDAAFSGFNGTLMAYGQTGTGKTYTM 107 >SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 66.1 bits (154), Expect = 4e-11 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +1 Query: 325 DKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGII 504 ++VF + E VY AK ++ V+ G+NGTIFAYGQT+SGKTHTM +GD GII Sbjct: 27 NQVFDQITSTEDVYGSFAKPVILSVMEGFNGTIFAYGQTASGKTHTM---MGDDSCPGII 83 Query: 505 PR 510 P+ Sbjct: 84 PQ 85 >SB_12394| Best HMM Match : Kinesin (HMM E-Value=1.3e-38) Length = 256 Score = 65.7 bits (153), Expect = 5e-11 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = +1 Query: 310 KVYLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEG 471 K + FD V N QE+V+ AK+IV + GYNGTIFAYGQT SGKT TM G Sbjct: 75 KTFSFDHVADTNTMQEEVFGAVAKNIVEGCVDGYNGTIFAYGQTGSGKTFTMLG 128 >SB_51895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1368 Score = 64.1 bits (149), Expect = 1e-10 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 5/104 (4%) Frame = +1 Query: 193 SIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGGKV-----YLFDKVFKPNATQE 357 S+RV+ + + D +E+ + + FP S+ G+ ++FD+VF A Sbjct: 403 SVRVMDQNVLVFDPDEECEA---INFPGASRKRARSVTGRRARDLRFIFDRVFNEEANNT 459 Query: 358 KVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 V+ K I+ VL G+N T+FAYG T +GKTHTM G +PG Sbjct: 460 DVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSNNNPG 503 >SB_39634| Best HMM Match : Kinesin (HMM E-Value=9.9e-39) Length = 244 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 20/129 (15%) Frame = +1 Query: 193 SIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGG-------------KVYLFDKV 333 S++V R RPLN+ E G+K I++ G ++ G K + FD Sbjct: 3 SVKVAVRVRPLNNRENNMGAKTIIEM-EGKKTRIYNVKGTNVTGEGERKNYVKDFSFDYS 61 Query: 334 F-------KPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGK 492 + + QE+V+ + +V GYN IFAYGQT SGKT+TM G GD Sbjct: 62 YWSVDERSRHFVNQERVFKDLGTDVVKAAFEGYNACIFAYGQTGSGKTYTMMGHNGD--- 118 Query: 493 QGIIPRXCQ 519 G+IPR C+ Sbjct: 119 TGLIPRICE 127 >SB_54210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 62.5 bits (145), Expect = 4e-10 Identities = 40/101 (39%), Positives = 57/101 (56%), Gaps = 8/101 (7%) Frame = +1 Query: 193 SIRVVCRFRPLNDSEEKA---GSK-FIVKF---PS-GPDDNCISIGGKVYLFDKVFKPNA 348 +I+V R P + E A G+K FI K PS G + ++ F+ +F P Sbjct: 3 NIKVYARLFPCQNPSELARVEGNKLFISKSSVQPSEGQKNGAVNEHEIGITFNGIFGPYC 62 Query: 349 TQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEG 471 +Q +V+ E A ++V + GYNGTIFAYGQT +GKT T+EG Sbjct: 63 SQSEVFGEVASTLVYKLFEGYNGTIFAYGQTGTGKTFTVEG 103 >SB_7436| Best HMM Match : Kinesin (HMM E-Value=0.00023) Length = 116 Score = 60.9 bits (141), Expect = 1e-09 Identities = 29/90 (32%), Positives = 47/90 (52%) Frame = +1 Query: 196 IRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGGKVYLFDKVFKPNATQEKVYNEA 375 ++V R RPL E + + G + I K + +D VF +++Q+++Y + Sbjct: 12 VKVAVRIRPLLHKEISEACQECISVTPG-EPQVIMGTNKAFTYDYVFGKSSSQKELYTDV 70 Query: 376 AKSIVSDVLAGYNGTIFAYGQTSSGKTHTM 465 ++ GYN T+ AYGQT SGKTH+M Sbjct: 71 VTPLLDGFFKGYNATVLAYGQTGSGKTHSM 100 >SB_40388| Best HMM Match : Kinesin (HMM E-Value=0) Length = 500 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/71 (39%), Positives = 45/71 (63%) Frame = +1 Query: 346 ATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ*H 525 A Q++VY++ K ++ GYN IFAYGQT +GK++TM G + G++GIIP+ + Sbjct: 20 ANQQQVYSDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKLEQAGQKGIIPQVS--Y 77 Query: 526 IXSHLCHXREL 558 + + H R+L Sbjct: 78 LEIYCEHVRDL 88 >SB_20166| Best HMM Match : Kinesin (HMM E-Value=0) Length = 378 Score = 55.2 bits (127), Expect = 7e-08 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 4/94 (4%) Frame = +1 Query: 196 IRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISI----GGKVYLFDKVFKPNATQEKV 363 I+V R RP D E++ V+ D + I + Y FD VF P A+ ++ Sbjct: 10 IQVYVRVRPFTDKEKERKEPNAVQIHH--DHSLIRVLDPRRETNYFFDGVFGPEASNHEL 67 Query: 364 YNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTM 465 Y + + +V L GY GT+ YGQT +GKT+T+ Sbjct: 68 YLKVGRPLVYAALNGYKGTLLTYGQTGTGKTYTL 101 >SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 54.8 bits (126), Expect = 9e-08 Identities = 25/61 (40%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = +1 Query: 337 KPN-ATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRX 513 +PN A Q +VY + K+++ + GYN T+FAYGQT SGK+ + ++G +GI+P Sbjct: 1056 QPNYADQRRVYEDVGKTVLQNAWEGYNSTLFAYGQTGSGKSWS---IVGYGANKGIVPIF 1112 Query: 514 C 516 C Sbjct: 1113 C 1113 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/56 (41%), Positives = 37/56 (66%) Frame = +1 Query: 352 QEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ 519 QEK+Y+ K +++ GYN +FAYGQT SGK+++ ++G + GI+PR C+ Sbjct: 350 QEKLYSLMGKPLLNSAFKGYNTCLFAYGQTGSGKSYS---IMGQGDELGILPRFCE 402 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 521 DIFXHIYAMXENLXXHIKVSYFEIYMDKIXXLLDXVQSKSPVSMXXKK 664 ++F I E L +++SYFEIY +KI LL V SK+ KK Sbjct: 403 ELFERIVIFTE-LKFTVEISYFEIYNEKIHDLL--VSSKTKDEKSRKK 447 >SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) Length = 296 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/56 (41%), Positives = 36/56 (64%) Frame = +1 Query: 352 QEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ 519 Q+ V+++ ++ GYN +FAYGQTS+GKT+TM +G + G+IPR C+ Sbjct: 138 QDTVFDDLGMGVLQAAYEGYNTCMFAYGQTSAGKTYTM---MGTNDEVGLIPRICK 190 >SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1492 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/58 (37%), Positives = 38/58 (65%) Frame = +1 Query: 346 ATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ 519 A Q+KV+++ ++ + GYN ++FAYGQT SGK+++M +G +GI+P C+ Sbjct: 77 ADQKKVFDDLGVGVLENAWKGYNCSLFAYGQTGSGKSYSM---VGYGANKGIVPIFCE 131 >SB_29744| Best HMM Match : Kinesin (HMM E-Value=6.3e-30) Length = 291 Score = 50.0 bits (114), Expect = 3e-06 Identities = 22/60 (36%), Positives = 34/60 (56%) Frame = +1 Query: 310 KVYLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 +++ FD+V A+ ++VY K +V L G G + AYGQT +GKT+T+ G G Sbjct: 10 RIFEFDQVLAQEASNDEVYRVVGKPLVEACLTGMTGILMAYGQTGAGKTYTLMAPRGITG 69 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 418 TIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXCQ*HIXSHL 540 TIFAYGQT +GKT TMEGV P + I+P HI H+ Sbjct: 2 TIFAYGQTGTGKTFTMEGVRSVPELRDIVPNSFA-HIFGHI 41 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = +1 Query: 316 YLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGK 453 + F +VF P TQ+ ++E + +V D + G N +F YG T+SGK Sbjct: 188 FTFSRVFGPETTQKDFFDETSLGLVRDFVDGQNCLVFTYGVTNSGK 233 >SB_18382| Best HMM Match : Kinesin (HMM E-Value=2.3e-14) Length = 278 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/67 (29%), Positives = 37/67 (55%) Frame = +1 Query: 307 GKVYLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDP 486 G ++F+ V+ + VY + + +V + AGYN ++ +G+T SGK+ ++ G Sbjct: 32 GTGHIFNSVYSQKSLTYDVYKDCCEPLVELLCAGYNTSLLLFGETGSGKSFSLAG--DKT 89 Query: 487 GKQGIIP 507 K G+IP Sbjct: 90 AKAGLIP 96 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = +1 Query: 367 NEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPR 510 +E ++++ + GYN IFAYGQT SGKT TM G D GI PR Sbjct: 528 SELDRNLIQSAVDGYNVCIFAYGQTGSGKTFTMIG-DRDGNFPGIAPR 574 >SB_40762| Best HMM Match : Kinesin (HMM E-Value=8.5e-15) Length = 224 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 316 YLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQTSSG 450 Y FD F +TQE++Y + ++ VL G N ++FAYG T +G Sbjct: 68 YQFDGFFNDQSTQEEIYRFSISPVMQYVLLGENTSVFAYGPTGAG 112 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 41.5 bits (93), Expect = 9e-04 Identities = 33/101 (32%), Positives = 45/101 (44%) Frame = +1 Query: 187 EDSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCISIGGKVYLFDKVFKPNATQEKVY 366 E IRV R RPL+ E+++G + + + D+ I KV + K + + Sbjct: 161 ESRIRVCVRKRPLSRDEKESGEEDVAAVNAR--DSIIISSPKVAVDLKKYTQQPPGQSDI 218 Query: 367 NEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPG 489 N + G T FAYG T SGKTHTM G PG Sbjct: 219 N---------ICRGVKATCFAYGCTGSGKTHTMLGTEDIPG 250 >SB_50557| Best HMM Match : Kinesin (HMM E-Value=9.6e-24) Length = 547 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 2/111 (1%) Frame = +1 Query: 190 DSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPD--DNCISIGGKVYLFDKVFKPNATQEKV 363 ++I+V RP + E S IV+ G DN + KV+ FD Sbjct: 4 ENIQVAVFVRPFTERELTEESVCIVEGEDGQVKVDNSENSRAKVFNFDHTG--------- 54 Query: 364 YNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRXC 516 E S++S GYN F+YG ++SGKT M G +P G+IP C Sbjct: 55 IEELGDSLLSSAFEGYNVCAFSYGASNSGKTCVMFGTNDNP---GLIPWIC 102 >SB_11127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 9/80 (11%) Frame = +1 Query: 202 VVCRFRPLNDSEEKAGSKFI------VKFPSGPDDNCISIGGKV---YLFDKVFKPNATQ 354 V CR +PL ++EE++ K I ++ + G ++ + F V+ N TQ Sbjct: 1 VYCRIKPLGENEEESCVKIIDNDSKLLQLTAPKFSQAFKSGHRIETQHTFKHVYDENTTQ 60 Query: 355 EKVYNEAAKSIVSDVLAGYN 414 + ++++ A +V DVL G N Sbjct: 61 KHLFDQVALPLVDDVLHGKN 80 >SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 310 KVYLFDKVFKPNATQEKVYNEAAKSIVSDVLAGYNG 417 K++ +D V+ N+ Q +Y+E + +V VL GYNG Sbjct: 573 KMFTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNG 608 >SB_25681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/67 (38%), Positives = 32/67 (47%), Gaps = 7/67 (10%) Frame = +1 Query: 187 EDSIRVVCRFRPLNDSEEKAGSKFIVKFPSGPDDNCIS--IGG-----KVYLFDKVFKPN 345 E +I+VV R RP N E K S IV + + IG K + FDKVF PN Sbjct: 9 EKNIQVVVRCRPRNGKEIKEASPAIVDCQPVKREITVQQDIGNNAHTTKTFTFDKVFAPN 68 Query: 346 ATQEKVY 366 + Q VY Sbjct: 69 SKQIDVY 75 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 340 PNATQEKVYNEAAKSIVSDVLAGYNGTIFAYGQ 438 P + N + VL+GYNGTIFAYGQ Sbjct: 39 PKELSDGYINNKREVYKFSVLSGYNGTIFAYGQ 71 >SB_43995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 427 AYGQTSSGKTHTMEG 471 AYGQT SGKTHTM G Sbjct: 2 AYGQTGSGKTHTMLG 16 >SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) Length = 534 Score = 31.5 bits (68), Expect = 0.95 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 355 EKVYNEAAKSIVSDVLAGYNGTIFAYGQ 438 +++Y++ A+ +++ L G+N T+F YGQ Sbjct: 1 DQLYHDLAEPLLNKALDGFNATLFVYGQ 28 >SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 362 TFSWVALGLNT-LSNKYTLPPIEMQLSSGPDGNFTINFEPAFSSESFSGR 216 TF W++L LN + Y +P + + S + N NF + S +SG+ Sbjct: 648 TFGWLSLWLNLFIYLMYLMPLTVLAVHSKQNENTICNFNSSISKSEYSGK 697 >SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -1 Query: 341 GLNTLSNKYTLPPIEMQLSSGPDGNFTINFEPAFSSESFSGRNRHT 204 G N L PP+EM +S+ N T F+ +F S F T Sbjct: 206 GNNLLHQPGRTPPVEMNISNPRSTNLTNGFDSSFDSGFFQPARTQT 251 >SB_14255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 358 KVYNEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPR 510 K+ A++ VS +LAGY A+G + T+EG++ + I R Sbjct: 307 KILISKAEAKVSSILAGYKAEARAFGDMMKRQNLTVEGLLSYLSTRAIADR 357 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,480,242 Number of Sequences: 59808 Number of extensions: 448755 Number of successful extensions: 903 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -